Trabajos 0 experience en LondonCrear alertas

A Level 3 Nursery Practitioner is a fully qualified early years educator who takes on a higher level of responsibility for planning, assessment, and leading daily activities within the room. \n \n Key Responsibilities \n\n • Curriculum Planning: Design and implement age-appropriate educational plans following the EYFS framework to support child development.\n, • Key Person Duties: Act as the dedicated Key Person for a specific group of children, tracking their milestones and managing their learning journeys.\n, • Assessments & Reporting: Complete accurate progress checks, including the 2-year-old developmental review, and write transition reports for school readiness.\n, • Parent Partnerships: Lead formal parent consultation meetings and provide expert advice on behavioral or developmental milestones.\n, • Team Mentoring: Guide and support Level 2 practitioners, apprentices, and students working within the room.\n, • Health & Safety: Maintain impeccable hygiene standards, administer medication in line with policies, and act as a vigilant safeguarding advocate.\n\n \n What We Are Looking For \n\n • Qualifications: A full and relevant Level 3 Diploma in Childcare / Early Years Educator qualification.\n, • Certifications: Valid Paediatric First Aid, Safeguarding Level 2, and Food Hygiene certificates.\n, • Experience: Proven experience working with children aged 0 to 5 years in a registered nursery setting.\n, • Expertise: Deep, practical knowledge of EYFS statutory frameworks, child development theories, and safeguarding legislation.\n, • Attributes: Excellent leadership potential, strong organizational skills, and a warm, professional communication style.\n\n

• Full-time, • Employee Status: Regular, • Role Type: Hybrid, • Department: Marketing and Communications, • Schedule: Full Time Experian is a global data and technology company, powering opportunities for people and businesses around the world. We operate across a range of markets, from financial services to healthcare, automotive, agribusiness, insurance, and many more. Experian invests in people and new advanced technologies to unlock the power of data. We have an amazing team of 25,200 people in 32 countries. We're looking for a consumer facing Senior Product Marketing Manager, you'll own the strategy behind some of our most important consumer propositions, partnering with Product from the earliest stages of discovery through to launch. You'll help identify customer problems worth solving, shape product direction, define compelling propositions and ensure every product we build delivers meaningful customer and commercial impact. This is a strategic, upstream role. You'll work alongside Product Managers, Designers, Researchers and Analysts to bring customer, market and competitive insight into the 0-1 product process. You'll influence directly what gets built, who it's built for and how we create products that can then scale in market. • Partner with the Innovation & Growth Domains from discovery through to launch, helping identify customer problems, validate opportunities and shape product direction., • Bring together customer, market and competitor insight to influence roadmap priorities and identify where we can create the greatest value., • Define target customer segments, value propositions and positioning for new products and features., • Lead product marketing for new innovations, propositions and features from concept through launch and optimisation., • Turn complex product capabilities into compelling customer propositions that drive understanding, adoption and growth., • Measure product adoption and customer outcomes, using insight and experimentation to continuously improve performance., • Build trusted partnerships across Product, Design, Research, Analytics and Marketing to deliver customer and commercial outcomes., • Influence senior stakeholders through evidence, customer insight and commercial thinking., • Champion modern product marketing by using AI and emerging technologies to accelerate customer insight, proposition development and decision-making., • Significant experience in B2C product marketing, product strategy or customer-led marketing within a digital consumer business., • Proven experience taking products, propositions or customer experiences from 0→1, working alongside Product Managers through discovery, validation, launch and iteration., • Demonstrable experience influencing product strategy and roadmap decisions through customer, market and competitive insight., • Strong experience defining positioning, propositions and go-to-market strategies that drive customer adoption., • Deep understanding of customer research, experimentation and data-informed product development., • Excellent stakeholder management skills, with the ability to influence senior Product, Design and Commercial leaders., • Experience using AI and modern tooling to accelerate insight generation, proposition development and product marketing workflows., • Comfortable operating in fast-moving environments with high levels of ownership, autonomy and ambiguity. Benefits package includes: • Hybrid working - 40% office based, • Great compensation package and discretionary bonus, • Core benefits include Pension, Bupa healthcare, Sharesave Scheme and more, • 25 days annual leave with 8 bank holidays and 3 volunteering days. You can purchase additional annual leave. Our uniqueness is that we celebrate yours. Experian's people first, inclusive and purpose driven culture is multi award-winning; World's Best Workplaces™ 2025 (Fortune Global Top 25), Great Place To Work™ in 26 countries to name a few. Check out Experian Life on social or explore our Careers Site to understand why. Experian is also proud to be an Equal Opportunity and Affiliation. If you have a disability or special need that requires accommodation, please let us know at the earliest opportunity. Grade: D/EB8 #J-18808-Ljbffr

At Elanco (NYSE: ELAN) – it all starts with animals! As a global leader in animal health, we are dedicated to innovation and delivering products and services to prevent and treat disease in farm animals and pets.At Elanco, we are driven by our vision of Food and Companionship Enriching Life and our purpose – all to Go Beyond for Animals, Customers, Society and Our People. At Elanco, we pride ourselves on fostering a diverse and inclusive work environment. We believe that diversity is the driving force behind innovation, creativity, and overall business success. Here, you’ll be part of a company that values and champions new ways of thinking, work with dynamic individuals, and acquire new skills and experiences that will propel your career to new heights. Making animals’ lives better makes life better – join our team today! Your role: Senior Product Manager - Enterprise AI As Senior Product Manager for Enterprise AI, you will drive the vision and execution for Elanco’s internal AI ecosystem, agentic platforms, and modern AI stack - including ElancoGPT - to boost productivity and decision‑making across the global workforce. Bridging complex AI capabilities with tangible business value, you will partner with IT and Data leadership to define a prioritized roadmap, maintain robust governance, and scale our Enterprise AI capabilities. Initially focused on Enterprise AI, this dynamic role offers the unique opportunity to broaden your impact by transitioning into other product spaces as new priorities and business objectives evolve. Your Responsibilities: Process & Continuous Improvement: Guide teams through lean process facilitation and data‑driven improvements while applying strategic insights to drive continuous problem‑solving and operational excellence. Talent Development & Mentorship: Mentor product managers to foster strategic growth, collaborative environments, and a deep, ongoing exploration of product expertise. Project Leadership & Strategic Agility: Drive complex projects with strategic agility, effectively navigating ambiguity, resolving challenges, and managing crisis situations to resolution. Customer & Product Strategy: Lead probing customer engagements to ensure design alignment, while utilizing product knowledge expansively to nurture the vision, roadmap execution, and thought‑leadership across Elanco. Stakeholder & Consensus Building: Expand strategic stakeholder relationships and pioneer engagement approaches through clear, persuasive communication that builds trust and consensus across all organizational levels. Business Alignment & Governance: Contribute substantially to functional and business goals by leading budgets, prioritizing strategic direction, and championing initiatives that act as catalysts for positive, cross‑functional change. What You Need to Succeed (minimum qualifications): Educational Background: Bachelor’s degree in a relevant field (e.g., computer science, data science, business). Required Experience: 10+ years technology experience showcasing strong learning agility at enterprise level. Additional Information: Travel: 0-10% Location: Hook, UK - Hybrid Work Environment Don’t meet every single requirement? Studies have shown underrepresented groups are less likely to apply to jobs unless they meet every single qualification. At Elanco we are dedicated to building a diverse and inclusive work environment. If you think you might be a good fit for a role but don't necessarily meet every requirement, we encourage you to apply. You may be the right candidate for this role or other roles! #LI-KS2 Elanco is an EEO/Affirmative Action Employer and does not discriminate on the basis of age, race, color, religion, gender, sexual orientation, gender identity, gender expression, national origin, protected veteran status, disability or any other legally protected status Elanco may use automated tools, including AI, to support parts of our recruitment process, such as reviewing applications against job‑related criteria and/or transferrable skills. These tools help ensure a consistent, structured evaluation, but they do not make hiring decisions. All decisions involve a human reviewer. For more information on how we handle personal data, please see our Elanco Workforce Privacy Notice. #J-18808-Ljbffr

We're looking for a talented infrastructure engineer who thrives on solving complex challenges at scale. This is your opportunity to shape the future of our technology landscape while growing your career alongside some of the best minds in the industry. At JPMorganChase, your expertise will directly influence how we scale our technology to meet evolving business demands. You'll drive technical strategy, mentor fellow engineers, and partner with cross-functional teams to deliver highly available, secure, and performant systems. As a Lead Infrastructure Engineer at JPMorganChase within the Network Services team, you will play a critical role in designing, building, and optimizing the infrastructure platforms that support our global operations. You will drive technical strategy, mentor fellow engineers, and partner with cross-functional teams to deliver highly available, secure, and performant systems. Your expertise will directly influence how we scale our technology to meet evolving business demands. The Network Connectivity Solution Engineer will be responsible for leading the requirements capture, tendering and design of network connectivity solutions across Europe, the Middle East, and Africa. This role partners with internal business stakeholders, service delivery teams and external telecom providers to ensure high-quality, timely, and cost-effective network solutions that meet business requirements and engineering standards. • Lead structured requirements capture with business and technology stakeholders; translate connectivity needs, constraints, and non-functional requirements (resilience, performance, compliance, operability) into well-defined solution requirements., • Develop end-to-end connectivity designs aligned to approved architectural patterns and reference architectures, producing high-level and low-level designs, network diagrams, implementation constraints, and documented assumptions., • Own the full tender and bid lifecycle for telecom connectivity solutions, including bid documentation, coordination of request-for-information/request-for-proposal activities with internal sourcing partners, technical and commercial evaluation, and formal documentation of vendor selection rationale., • Embed resilience and operational risk controls into all designs, including path and carrier diversity, elimination of single points of failure, serviceability and monitoring requirements, and clearly defined demarcation and escalation models., • Lead design reviews and architecture governance; manage design exceptions with documented risk acceptance and ensure decisions adhere to established engineering standards and controls., • Design and implement scalable, resilient infrastructure architectures that support business-critical applications and services., • Collaborate with telecom service providers, vendors, and internal engineering teams across the bid and design lifecycle to ensure solutions are technically sound, commercially viable, and deliverable within defined constraints., • Manage supplier relationships and performance governance, holding providers accountable to service level agreements, driving service improvement plans, and conducting recurring quality and performance reviews., • Support regional and global network strategy execution through process improvements and service optimization; serve as the telecom connectivity market expert for Europe, the Middle East, and Africa (carrier landscape, emerging technologies, pricing trends, supplier capabilities), lead evaluation/adoption of new technologies, and mentor junior engineers., • Uses enterprise-authorized AI capabilities within the work environment to accelerate infrastructure analysis and design documentation, validating outputs and handling operational data according to sensitivity and security requirements., • Applies reuse-first, AI-assisted practices within delivery and automation routines to identify recurring issues and validate remediation options, ensuring changes are traceable/auditable and aligned to resiliency and security expectations., • Formal training or certification on infrastructure engineering concepts and applied experience., • Expertise in cloud platforms such as AWS, Azure, or GCP, including compute, storage, and networking services., • Deep knowledge of networking and telecommunications technologies (Layers 0-3), including dark fiber, DWDM, Ethernet, IP-VPN, DIA, broadband, cellular and satellite connectivity., • Demonstrated expertise in the Europe, the Middle East, and Africa telecom connectivity market, including in-depth knowledge of regional carrier ecosystems, infrastructure landscapes, and connectivity product offerings across key markets., • Excellent communication and stakeholder management skills, with the ability to influence and build trust across business and technical domains., • Solid organizational and time management skills, with the ability to manage multiple concurrent project across geographies., • Uses enterprise-authorized AI capabilities within the work environment to accelerate infrastructure analysis and design documentation, validating outputs and handling operational data according to sensitivity and security requirements., • Applies reuse-first, AI-assisted practices within delivery and automation routines to identify recurring issues and validate remediation options, ensuring changes are traceable/auditable and aligned to resiliency and security expectations., • Experience using Atlassian tools (Jira and Confluence) for workflow, documentation and reporting., • Familiarity with cloud connectivity and hybrid architectures., • Relevant cloud certifications (e.g., AWS Solutions Architect, Azure Administrator)., • Data analytical skills – ability to interrogate, model and visualize large datasets to identify trends, cost drivers, or delivery risks., • Experience in financial services or other highly regulated industries. #J-18808-Ljbffr

Relay is fundamentally reshaping how goods move in an online era. Backed by Europe's largest-ever logistics Series A ($35M) led by deep-tech investors Plural, and a recently closed Series B ($60M), Relay is scaling faster than 99% of venture-backed startups. We're assembling the most talent-dense team the logistics industry has ever seen to free commerce from friction. Today, high delivery costs act as a hidden tax on e-commerce, quietly shaping what can be sold online and limiting who can participate. We envision a world where more goods move more freely between more people, making the online shopping experience seamless and accessible to everyone • ~160 people, around half in engineering, product and data, • 45+ advanced degrees across computer science, mathematics and operations research, • Thousands of data points captured, calculated, analysed and predicted for every single parcel we handle, • An intellectually vibrant culture of first-principles thinking, tight feedback loops and relentless experimentation We're building a finance function that scales faster than the business - not by adding headcount, but by designing a system where AI, automation, and clean architecture do the heavy lifting. We're looking for someone to build that system from scratch: the finance stack, the AI workflows, and the operating model that ties it all together. Reporting to our CFO, you'll work directly with founders and functional leaders to turn Relay's finance function into a real-time decision engine. This is not a "transformation" role in the traditional sense. This is a 0 to 1 build role with direct leverage on company velocity. • Design the finance function from first principles. Own how finance operates in an AI-native, high-growth company - not as an improvement on legacy systems, but as a definition of the default state. Rebuild core processes (R2R, P2P, O2C, FP&A) to eliminate manual work before it takes root., • Deploy AI across every high-leverage workflow Identify and ship use cases in weeks, not quarters - AI-driven forecasting and scenario modelling, automated reporting and commentary, close and reconciliation workflows, and collections, risk, and anomaly detection., • Build and own the technical stack Select the minimum viable, maximum scalable architecture. Make strong calls on ERP vs lightweight tooling, build vs buy, and data design. Ensure everything is modular, API-friendly, and AI-ready from day one., • Work directly with engineering and data teams Translate financial logic into production systems. This is a hands-on, cross-functional role - you're putting ideas into production, not handing them over., • Redesign the operating model around augmentation Define how humans and AI work together - including which roles don't need to exist. Build a function where one great operator and AI outperforms five traditional hires., • Deliver the outcomes leadership needs Reduce time to close, time to forecast, and time to decision. Give leadership real-time, high-quality financial insight, and build systems that scale from current revenue to £100M+ without breaking., • You've built or redesigned finance systems and operating models end-to-end - not just advised on them., • You've deployed automation or AI in real finance workflows. Production, not strategy decks., • You're fluent in the TA and Ops/data hybrid: FP&A, R2R, funnel diagnostics, and partnering with RevOps/FP&A to forecast and drive decisions., • You're thinking in systems, not processes - and you're comfortable making decisions with incomplete information., • You've worked closely with CFOs, founders, or operators on scaling finance in high-growth environments., • Proven experience owning finance programs and delivering systems implementations end-to-end., • Hands-on deployment of AI or automation in real finance workflows., • Experience in hypergrowth startups or scale-ups., • Strong technical fluency - comfortable working directly with engineering and data teams., • Structured, clear communicator with strong stakeholder management skills., • Generous equity, richer than 99% of European startups, with annual top-ups to share Relay's success., • Private health & dental coverage, so comprehensive you'd need to be a partner at a Magic Circle law firm to match it., • 25 days of holidays, • Enhanced parental leave., • Hardware of your choice., • Extensive perks (gym subsidies, cycle-to-work, Friday office lunch, covered Uber home and dinner for late nights, and more)., • Talent Acquisition Interview - 30 min, • HM interview - 45min, • Case Exercise - 90min, • Final round Interview - 60 min our process mirrors our pace of work, typically completed in a week. • Aim with Precision: You define problems clearly and measure your impact meticulously., • Play to Win: You chase bold bets, tackle the hard stuff, and view constraints as fuel, not friction., • 1% Better Every Day: You believe that small, consistent improvements lead to exponential growth. You move quickly, deliver results, and learn from every experience., • All In, All the Time: You show up and step up. You take ownership from start to finish and do what it takes to deliver when it counts., • People-Powered Greatness: You invest in your teammates. You give and receive feedback with care and candour. You build trust through high standards and shared success., • Grow the Whole Pie: You seek out win-win solutions for merchants, couriers, and our customers, because when they thrive, so do we. Relay is an equal-opportunity employer committed to diversity, inclusion, and fostering a workplace where everyone thrives. #J-18808-Ljbffr

Harmonic have been retained by an exceptionally high-growth, VC-backed logistics-technology company on a mission to strip the hidden cost of delivery out of ecommerce, making it easier for more goods to move between more people. Backed by several tier-1 investors, this is one of the fastest-scaling venture-backed businesses in Europe, and finance is being built from scratch to keep pace. They're building a finance function that scales faster than the business, not by adding headcount, but by designing a system where AI, automation and clean architecture do the heavy lifting. They're looking for someone to build that system from scratch: the finance stack, the AI workflows, and the operating model that ties it all together. Reporting to the CFO, you'll work directly with founders and functional leaders to turn finance into a real-time decision engine. This is not a "transformation" role in the traditional sense. This is a 0 to 1 build role with direct leverage on company velocity. • Design the finance function from first principles: own how finance operates in an AI-native, high-growth company, not as an improvement on legacy systems, but as a definition of the default state. Rebuild core processes (record to report, procure to pay, order to cash, FP&A) to eliminate manual work before it takes root., • Deploy AI across every high-leverage workflow: identify and ship use cases in weeks, not quarters. AI-driven forecasting and scenario modelling, automated reporting and commentary, close and reconciliation workflows, and collections, risk and anomaly detection., • Build and own the technical stack: select the minimum viable, maximum scalable architecture. Make strong calls on ERP vs lightweight tooling, build vs buy, and data design. Ensure everything is modular, API-friendly and AI-ready from day one., • Work directly with engineering and data teams: translate financial logic into production systems. This is a hands-on, cross-functional role; you're putting ideas into production, not handing them over., • Redesign the operating model around augmentation: define how humans and AI work together, including which roles don’t need to exist. Build a function where one great operator and AI outperforms five traditional hires., • Deliver the outcomes leadership needs: reduce time to close, time to forecast and time to decision. Give leadership real-time, high-quality financial insight, and build systems that scale to GBP100m+ revenue without breaking., • You've built or redesigned finance systems and operating models end to end, not just advised on them., • You've deployed automation or AI in real finance workflows. Production, not strategy decks., • You think in systems, not processes, and you're comfortable making decisions with incomplete information., • You've worked closely with CFOs, founders or operators on scaling finance in high-growth environments., • Proven experience owning finance programmes and delivering systems implementations end to end., • Strong technical fluency; comfortable working directly with engineering and data teams., • A structured, clear communicator with strong stakeholder management skills. Salary: c.GBP120,000-GBP150,000 + equity Farringdon, London / hybrid At Harmonic, we are dedicated to fostering an inclusive and equitable workplace. We actively welcome applications from individuals of all backgrounds and assure you that every candidate will be thoughtfully considered for the roles we represent, without regard to race, religion, gender expression, disability, or sexual orientation. At Harmonic, we are dedicated to fostering an inclusive and equitable workplace. We actively welcome applications from individuals of all backgrounds and assure you that every candidate will be thoughtfully considered for the roles we represent, without regard to race, religion, gender expression, disability, or sexual orientation. #J-18808-Ljbffr

Location: London, LND, GB Work Arrangement: Hybrid Location : Wimbledon (2 days) Reports to : Head of Drugstores and Distributors Direct Reports :0 Scope / Brands : Manage the Clairol, Wella, Silvikrin and Shockwaves portfolio in 2 of the UK’s biggest Drugstores (Boots and Superdrug) Together, WE enable individuals to look, feel, and be their true selves. WellaCompany is one of the world’s leading beauty companies, comprised of a family of iconic brands such as Wella Professionals, Clairol, OPI, Nioxin and ghd. With 6,000 employees globally, presence in over 100 countries, WellaCompany and its brands enable consumers to look, feel, and be their true selves. As innovators in the hair and nail industry, WellaCompany empowers its people to delight consumers, inspire beauty professionals, engage communities, and deliver sustainable growth to its stakeholders. The role of Senior National Account Manager is to lead account management of specified Drugstore customers to build profitable sales growth by supporting the Head of Sales on our leading brands. As a dynamic business leader, you will drive new opportunities for Wella, developing and maintaining exceptional relationships with our retail partners across all relevant departments within the customer business. You will be a commercial expert who will help design the Retail Hair strategy, set ambitious growth plans for the Drugstore channel, implement the plan from vision to execution, and have strong selling and negotiation skills to win in this channel. Lead Projects for the benefit of total Retail Hair UK/I Sales Team to improve capability across total UK Retail Hair Sales. This role is a 14 Month Fixed Term Contract Business Planning • Understanding of customer objectives and direction, • Plan, develop, agree and implement an annual Joint Business Plan with the specified customer, activating contingency plans when necessary., • Maximise commercial value of consumer insight data from Nielsen, Kantar, etc, • Agree promotional forecast with Demand Planning to support the achievement of annual Forecasting Accuracy objectives, • Agree monthly promotional support packages with customers including second sites, trade marketing and online support, • Co-ordinate total UKI Wella Plan for Boots and lead this relationship co-ordinating with colleagues on OPI and Pro Hair Negotiation • Agree listings for all new products and brands as appropriate, • Negotiate cost price changes with the customer as appropriate, • Submit all cost price change paperwork to the account and internally in an accurate and timely manner Forecasting/Supply Chain • Build contacts with the forecasting and supply chain teams within the customer to work together to manage the most cost-effective supply chain delivering all potential operational efficiencies, • Manage monthly, quarterly and annual sales forecasts and provide rationale to Head of Sales, • Manage Gross to net controls to optimise profitability, • Manage an investment plan to drive consumer awareness whilst maximising profitability, • Deliver maximum consumer engagement from trade investment, • Accurately prepare financial accrual requests and implement these with the Commercial team, • Work with the customer and Customer Services to minimise receivables to achieve target Debtor days for the customer, • Authorise all invoices for payment within 7 days of receipt or manage prompt agreement to amend or cancel invoices if raised in error by the customer Relationships • Build relationships with the specified Drugstore customers at all levels of customer business, • Be the voice of the Drugstores within Wella Retail Hair, • Escalate appropriately on important issues or ones that cannot be resolved, • Senior Account Management experience with extensive experience in Customer & Sales Management and leading negotiations, • Advanced planning, monitoring and analytical skills & knowledge of supporting programs and platforms, • Advanced experience of Consumer and Shopper Insights, • Proficiency in budget planning and P&L management, • Organises their own work and that of others, taking responsibility for the quality of all deliverables, • Strong team player and collaborates easily with others, seen as a role model and creates a positive environment while remaining focused on priorities and tackling obstacles, keeping the team motivated and engaged, • Communicates effectively and delivers impactful presentations. Communication & influencing will be second nature. Excellent written and verbal communication skills and can manage cross functional relationships, • You will be committed to delivering results and strives to achieve stretch targets. A true change champion you will pioneer new ideas and approaches showing a strong sense of individual accountability and ability to work with autonomy, • Have a flexible approach and adapts to challenges and changing priorities as required, comfortable making fast decisions balancing intuition and facts, • 25 days holiday + additional day off for your birthday (not including bank holidays), • 3 days’ personal leave for your own signification life events, • 2 paid days off for volunteering/charity work, • Optional Wella Pension Scheme (8% employer contribution, 3% employee contribution), • Optional Family Private Medical Insurance Cover, • Income Protection, • Life Insurance (8x base salary up to 2 million payable in the event of your death in service of Wella), • Staff Discount (80% of all hair products, 40% OPI, 1 x 50% ghd), • EAP (Employee Assistance Program), • Enhanced maternity, paternity, and adoption leave, • Eye Tests, • WOW Program (Bonus following exit from KKR, eligible after successful probation. For permanent employees only), • Workplace/Nursery Benefits, • 4 weeks working remotely abroad, • Early Friday Finish during Summer Wella Companywants to meet the aims and commitments set out in its equality policy. This includes not discriminating under the Equality Act 2010 and building an accurate picture of the make-up of the workforce in encouraging equality and diversity. We offer equal employment opportunity to qualified individuals without regard to race, religion or belief, color, national origin, age, gender,disability, sexual orientation, gender identity, gender expression, marital or civil partnership, pregnancy and maternity, veteran status, or any other characteristic protected by law. Wella Company with federal and state disability laws and makes reasonable accommodations for applicants and employees with disabilities. If reasonable accommodation is needed to participate in the job application or interview process, to perform essential job functions, and/or to receive other benefits and privileges of employment, please contact us at: https://www.wellacompany.com/consumer-affairs We strongly believe that cultivating a diverse workplace gives a company strength. The combination of unique skills, abilities, experiences and backgrounds creates an environment that produces extraordinary results. EOE Minorities/Females/Protected Veterans/Disabled. English - Please click on this link to review the Notification of Equal Opportunity Rights poster #J-18808-Ljbffr

We help the world run better At SAP, we keep it simple: you bring your best to us, and we'll bring out the best in you. We're builders touching over 20 industries and 80% of global commerce, and we need your unique talents to help shape what's next. The work is challenging – but it matters. You'll find a place where you can be yourself, prioritize your wellbeing, and truly belong. What's in it for you? Constant learning, skill growth, great benefits, and a team that wants you to grow and succeed. What you’ll build: At SAP, we help the world run better. As a Sovereign Cloud Architect & Advisor, you will be at the forefront of enabling customers to modernize their IT landscapes through trusted cloud solutions that meet regulatory, security, and compliance requirements. You will serve as a strategic partner, trusted advisor, and cloud visionary, helping customers navigate complex hybrid environments and design cloud strategies that accelerate innovation while preserving compliance. Working with customers, partners, and internal experts, you will: • Define sovereign cloud strategies that balance innovation, security, compliance, and operational excellence., • Build transformation roadmaps that guide customers from their current landscape to a future-ready cloud operating model., • Architect trusted hybrid and multi-cloud solutions across platforms such as SAP Cloud Infrastructure, AWS, Microsoft Azure, and Google Cloud Platform., • Enable resilient and compliant environments that support business continuity, data sovereignty, and regulatory requirements., • Create lasting customer relationships as a strategic advisor throughout their cloud transformation journey. What you bring: • Strong customer-facing communication and presentation skills, with the ability to engage executives, architects, and technical stakeholders., • Deep knowledge of SAP solutions, industry offerings, product roadmaps, and solution dependencies., • Solid expertise in cloud infrastructure and platform technologies, including virtualization, compute, networking, storage, and hybrid/multi-cloud architectures., • Hands‑on experience with Hyperscaler such as AWS, Microsoft Azure, Google Cloud Platform (GCP), and SAP Cloud Infrastructure (SCI); relevant certifications are highly valued., • Extensive SAP technology background, including SAP HANA, SAP S/4HANA, SAP NetWeaver, OS/DB migrations, SAP BTP, HANA Cloud, AI and enterprise architecture frameworks such as TOGAF., • Understanding SAP BTP, integration architectures, cybersecurity, compliance, data privacy, and sovereign cloud principles; experience in regulated industries or the public sector is a plus., • 10+ years of customer-facing SAP consulting experience and 8+ years in enterprise architecture, solution design, or SAP implementation, with exposure to pre‑sales, service delivery, ITSM, and SAP operations. Where you belong: Sovereign Cloud solutions help organisations meet evolving data privacy, residency, compliance, and sovereignty requirements while accelerating their cloud transformation journey. The Sovereign Services & Delivery (SS&D) business unit, part of SAP's Customer Value Group, specialises in delivering end-to-end sovereign cloud solutions for sectors like public and highly regulated industries etc. * Due to the potentially classified nature of our work, your willingness is required to subject yourself to a governmental security clearance process** Bring out your best SAP innovations help more than four hundred thousand customers worldwide work together more efficiently and use business insight more effectively. Originally known for leadership in enterprise resource planning (ERP) software, SAP has evolved to become a market leader in end-to-end business application software and related services for database, analytics, intelligent technologies, and experience management. As a cloud company with two hundred million users and more than one hundred thousand employees worldwide, we are purpose-driven and future-focused, with a highly collaborative team ethic and commitment to personal development. Whether connecting global industries, people, or platforms, we help ensure every challenge gets the solution it deserves. At SAP, you can bring out your best. We win with inclusion SAP’s culture of inclusion, focus on health and well-being, and flexible working models help ensure that everyone – regardless of background – feels included and can run at their best. At SAP, we believe we are made stronger by the unique capabilities and qualities that each person brings to our company, and we invest in our employees to inspire confidence and help everyone realize their full potential. We ultimately believe in unleashing all talent and creating a better world. SAP is committed to the values of Equal Employment Opportunity and provides accessibility accommodations to applicants with physical and/or mental disabilities. If you are interested in applying for employment with SAP and are in need of accommodation or special assistance to navigate our website or to complete your application, please send an e-mail with your request to Recruiting Operations Team: Careers@sap.com. For SAP employees: Only permanent roles are eligible for the SAP Employee Referral Program, according to the eligibility rules set in the SAP Referral Policy. Specific conditions may apply for roles in Vocational Training. Qualified applicants will receive consideration for employment without regard to their age, race, religion, national origin, ethnicity, gender (including pregnancy, childbirth, et al), sexual orientation, gender identity or expression, protected veteran status, or disability, in compliance with applicable federal, state, and local legal requirements. Successful candidates might be required to undergo a background verification with an external vendor. AI Usage in the Recruitment Process For information on the responsible use of AI in our recruitment process, please refer to our Guidelines for Ethical Usage of AI in the Recruiting Process. Please note that any violation of these guidelines may result in disqualification from the hiring process. Requisition ID: 459216 | Work Area: Software-Development Operations | Expected Travel: 0 - 10% | Career Status: Professional | Employment Type: Regular Full Time | Additional Locations: #LI-Hybrid #J-18808-Ljbffr

Did you know you can receive job alerts via WhatsApp? Important: West Hertfordshire Teaching Hospitals NHS Trust does not charge any fees at any stage of the recruitment process, including job applications, sponsorship arrangements or employment offers. If you receive a job offer or recruitment communication and are unsure whether it is genuine, please verify it using the contact details published on this website. Any request for payment should be treated as fraudulent. We are seeking an exceptional and visionary leader to join our Executive Team as Chief Redevelopment Officer. This role will lead the day-to-day delivery of the Trust's acute redevelopment programme, including OBC, procurement, FBC and delivery phases. The role will oversee clinical and service transformation alongside the construction and delivery of new and redeveloped hospital facilities across all three of the Trust's main sites. The post holder will establish and implement robust programme and project delivery structures to support the successful delivery of the Trust's redevelopment ambitions. They will ensure investment and change management programmes and projects are delivered within approved financial constraints, are affordable and deliver value for money. The post holder will work with key delivery partners, in particular with University College London Hospital NHS Foundation Trust and colleagues at Mount Vernon Cancer Centre on the combined Watford scheme, and with Local Government partners in taking forward our shared ambitions at St Albans and Hemel Hempstead. As a member of the Executive Team and Trust Board, you will provide strategic leadership and assurance for a major portfolio of redevelopment activity. You will lead complex procurement and commercial processes, oversee programme governance arrangements, and ensure effective management of risk, issues and opportunities. You will build and maintain strong relationships with key stakeholders, including clinical leaders, patients, regulators, system partners and external advisors, ensuring they remain engaged throughout the programme. You will also lead multidisciplinary teams, manage external suppliers and contractors, and ensure appropriate contractual arrangements are in place. The role will be responsible for driving the successful implementation of associated transformation programmes, ensuring services transition effectively into new facilities and intended benefits are realised. Regular reporting to the Board and relevant committees will be required to provide assurance on progress, performance and delivery. With a new hospital planned for Watford, work underway to update theatres at St Albans City Hospital and plans for a neighbourhood healthcare centre in Hemel Hempstead, this is an exciting time to join us. We are building on the success of our award-winning virtual hospital and re-imagining models of care, working closely with partners and making the most of advances in digital healthcare. Staff wellbeing and development are a priority, as is the role of innovation in improving clinical care, outcomes and patient experience. Our vision is Excellent patient care, together and our values are to be empowered, compassionate, professional and inclusive. They capture an important balance across what we must all do as individuals and to support others. The post holder will ensure effective engagement with staff, patients, people with lived experience, and partner organisations, embedding their input into planning and decision-making processes. The role will act as a key representative of the Trust at regional and national meetings, developing productive relationships with health partners, regulators and other external organisations. The post holder will oversee the performance management of external advisers and suppliers, ensuring services are delivered to the required quality and standards. They will also ensure appropriate information systems, controls and reporting mechanisms are maintained to support effective decision-making and programme assurance. The role will be responsible for ensuring that governance, assurance and compliance arrangements remain effective, supporting informed decision-making and enabling successful outcomes across a complex and evolving programme environment. • 2=fully meets, 1=partially meets, 0=does not meet West Hertfordshire Teaching Hospitals NHS Trust provides acute healthcare services to a core catchment population of approximately half a million people living in west Hertfordshire and the surrounding area. The Trust also provides a range of more specialist services to a wider population, serving residents of North London, Bedfordshire, Buckinghamshire and East Hertfordshire. As an employer of nearly 6,000 people the Trust is one of the biggest employers in the area and sees nearly a million patients each year. The postholder will have access to vulnerable people in the course of their normal duties and as such this post is subject to the Rehabilitation of Offenders Act 1974 (Exceptions) Order 1975 (Amendment) (England and Wales) Order 2020 and as such it will be necessary for a submission for Disclosure to be made to the Disclosure and Barring Service to check for any previous criminal convictions. #J-18808-Ljbffr

Indra is a leading global technology and consulting company, and a trusted technological partner for the core business operations of its clients worldwide. It stands at the forefront of key sectors including Transport, Defence, Air Traffic Management and Space, alongside advanced Information Technology services delivered through Minsait, and cutting-edge capabilities in Sovereign AI, Cybersecurity, and Cyberdefence via IndraMind. The company's business model is built around a comprehensive portfolio of proprietary products, combining strong innovation with a high-value focus for customers. With more than 2,500 projects implemented across 50 countries and over 100 cities, Indra is a global benchmark in innovative transportation and mobility solutions. It is recognised as one of the world's top three companies in public transportation management systems. Indra's technology supports the daily journeys of over 78 million people, helping to reduce more than 10 million tonnes of CO₂ emissions annually, and helping save nearly 3,000 lives through improved traffic management and road safety. Indra Group is paving the way to a more secure and better-connected future through innovative solutions, trusted relationships and the very best talent. Sustainability sits at the heart of its strategy and culture, driving efforts to address current and future social and environmental challenges. In the 2024 financial year, Indra achieved revenues of €5.5 billion, over 60,000 professionals, maintained a local presence in 46 countries, and operated across more than 140 countries worldwide. As the technological partner for its customers' key operations, Indra is at the core of their business, and Indra's four values guide everything we do: Innovation - Our capacity for innovation, cutting-edge solutions, and specialised team of professionals enables us to drive a safer, more connected future through technology. Trust - We work with strength, commitment, and reliability, delivering quality solutions to build trust with customers, employees, partners, investors, and society. Connection - We harness the power of collaboration, connect ideas and solutions, and adapt to our customers' needs, supporting them on the path to a better future. Foresight - We anticipate future needs to make the world safer and more connected, transforming our experience and knowledge into solutions for a better tomorrow. Transport for London (TfL) has awarded Indra a long-term contract to operate, develop, enhance and expand ticketing and access control systems across London's transport network through to 2034, with extension options to 2039. This programme covers the maintenance, operation and evolution of a large-scale, complex ecosystem, including turnstiles, validators, ticket machines, sales terminals, back-office systems, payment gateways, IT infrastructure and cybersecurity that supports over 8.6 million daily journeys. Therefore, Indra will become TfL's strategic technology partner to guarantee the operation and evolution of the world's largest and most sophisticated ticketing system. Following a transition period of approximately two years, Indra will serve as the sole provider across the network that includes more than 8,500 buses, nearly 400 Underground stations, around 300 rail stations (Overground, DLR, Elizabeth Line and suburban services), 4,000 Oyster Card outlets, seven customer service centres, and 24 river boat boarding points. Drawing on over 30 years of experience in urban public transport solutions, Indra will manage and evolve all aspects of the system. The project also envisages, in partnership with TfL, the implementation of new technologies to develop the system, make it more efficient and automate key processes; in short, to jointly create the next generation of the ticketing system for London. The Senior Security Consultant plays a pivotal role in shaping and executing the organisation's information security strategy, governance and risk management activities to protect services, systems and data. The role is responsible for implementing security frameworks, leading risk and incident management, ensuring regulatory compliance, managing third-party security, and driving continuous improvement through monitoring, reporting and awareness initiatives. • Define, implement and monitor corporate information security strategies, objectives and governance frameworks., • Design and implement information security management systems and security master plans., • Lead risk management activities, including risk identification, assessment, treatment and reporting., • Define cybersecurity action plans and oversee their execution., • Ensure the protection of services, business processes and information assets., • Oversee security monitoring, incident investigation and response activities, including coordination of disciplinary or legal actions where required., • Manage and coordinate independent security audits and remediation follow-up activities., • Drive continuous improvement by monitoring security performance, reporting on security posture and defining corrective actions., • Develop and manage dashboards and metrics for operational security reporting., • Support business continuity by performing business impact analyses and defining continuity and testing plans., • Implement and maintain information security controls aligned with applicable laws, regulations, standards and best practices, including ISO 27001/27002, GDPR, Cyber Assessment Framework (CAF) and NIST CSF., • Develop and maintain information security policies, standards and procedures, ensuring organisational compliance., • Define, coordinate and assess the implementation of specific security controls for new systems and services., • Manage supplier and third-party security, including supply chain security considerations., • Deliver security awareness and training initiatives to promote a strong security culture across the organisation., • First 3 months: 2 days onsite per week, • Thereafter: fully remote with a maximum of 0-1 day onsite (as required), • Minimum of 8 years' experience in information security governance, management and operations, including the delivery of security projects in large and complex organisations., • Bachelor's or Master's degree in Computer Engineering, Telecommunications Engineering or a related discipline., • At least two of the following certifications: CISA, CISM, CRISC, CISSP, ISO 27001 Lead Auditor, ISO 27001 Lead Implementer, ISO 22301 Lead Auditor, CEH, CCSP or SSCP., • Willingness to travel when required., • Experience in the design and implementation of other management systems, such as ISO 27701, ISO 22301, ISO 20000, ISO 9001 and ISO 14001., • Knowledge of security in cloud environments, artificial intelligence, industrial control systems (ICS), operational technology (OT) and the Internet of Things (IoT)., • Knowledge of physical security principles and controls., • Experience with GRC tools such as ARCHER, GlobalSuite or similar platforms., • Experience performing compliance and certification audits, including ISO 27001 and GDPR., • Hands-on exposure to technical security solutions and controls., • Knowledge of sector‑specific regulatory and security frameworks in areas such as banking, energy, telecommunications and media, industrial protection, and critical infrastructure protection., • Knowledge of SOC operations, digital forensics and fraud management., • Experience with GRC / IRM platforms and the automation of security and compliance processes., • Additional security certifications such as CGEIT, C CISO, QSA, CDPP, or Security Director certification issued by the Spanish Ministry of the Interior., • Strong analytical and problem-solving skills., • Collaborative mindset and ability to work effectively in multidisciplinary teams., • Capacity for continuous learning, innovation and adaptation., • Proactive approach with a strong sense of ownership and initiative., • High level of integrity, accountability, commitment and professional confidence., • Strong customer focus and results orientation., • Holidays: 25 days per annum + 8 days bank holidays (options to buy/sell days)., • Pension - 4% employee and 4% employer., • Private medical insurance (including dental & optical)., • Life assurance., • Income protection., • Employee assistance programs., • Flexible/remote working options., • Charitable initiatives., • Social events (formal & informal)., • Learning and development programs., • Innovative & collaborative work environment. Indra is an equal employment opportunity employer. Applicants are considered without regard to race, colour, religion, sex, sexual orientation, gender identity, origin, disability or other characteristics protected by law. #J-18808-Ljbffr

SEN GCSE Tutor - Bromley Position: SEN Specialist Tutor - Outreach Tuition Age Range: Secondary - Year 7 to GCSE mainly Subjects: Maths and English essential; Science desirable Hours: 0-40 hours per week (0-hour contract) Typical Referral: 10-15 hours per week per student Pay Rate: £25-£35 per hour Contract Type: Ongoing / Long-Term Working Hours: Primarily during school hours About the Role We are seeking dedicated and experienced SEN Specialist Tutors to provide personalised, one-to-one outreach tuition to secondary-aged students across Bromley, from Year 7 through to GCSE. This role is ideal for a tutor who is passionate about supporting young people who may be struggling to access mainstream education due to additional learning needs, SEND, school anxiety, or other barriers to education. You will deliver engaging and highly individualised tuition programmes designed to help students re-engage with learning, rebuild confidence, develop essential skills, and make meaningful academic progress. Maths and English teaching experience is essential. The ability to teach Science at secondary level, particularly GCSE, is highly desirable. Most referrals involve approximately 10-15 hours of tuition per student per week, generally delivered during school hours, although flexibility may be required depending on the individual learner and referral. This is an outreach-based role, so tuition may take place in a learner's home, community setting, or another suitable agreed location. About the Students The students you support may have a range of additional needs and barriers to education, including: Autism Spectrum Condition (ASC/ASD) ADHD Dyslexia Dyscalculia Speech and Language Difficulties SEMH (Social, Emotional and Mental Health) needs School anxiety Emotionally Based School Avoidance (EBSA) Previous disengagement from mainstream education Gaps in learning or difficulties accessing the curriculumYou will need to be confident adapting your approach to meet the individual needs of each learner and creating a calm, supportive environment where they can feel safe and successful. Key Responsibilities Deliver high-quality, one-to-one outreach tuition to secondary-aged learners from Year 7 to GCSE. Teach Maths and English confidently across the secondary age range. Assess individual learning needs and identify gaps in knowledge. Plan and deliver structured, personalised learning programmes. Adapt teaching methods and resources to suit different SEND profiles and learning styles. Support learners to work towards their EHCP targets, curriculum objectives and academic goals. Help students prepare for GCSEs and other relevant examinations where appropriate. Build positive, trusting relationships with learners who may have experienced significant barriers to education. Monitor progress and maintain accurate records of learning, engagement and achievement. Provide appropriate feedback and updates to parents, carers, schools and relevant professionals. Work collaboratively with families and other professionals involved in the learner's education. Candidate Requirements We are looking for tutors who have: Strong experience teaching secondary Maths and English. Experience working with students from Year 7 through to GCSE. Previous experience supporting children or young people with SEN/SEND; a minimum of two years' experience is preferred. A strong understanding of different SEND profiles and effective strategies for supporting learners with additional needs. The ability to engage and motivate students who may be anxious, disengaged or reluctant to learn. Excellent communication and relationship-building skills. A patient, adaptable and empathetic approach. The ability to work independently and confidently within an outreach environment. Strong organisational skills and the ability to plan structured, purposeful sessions. An Enhanced DBS registered on the Update Service, or willingness to obtain one. A genuine passion for helping young people overcome barriers to education and achieve their potential. Essential Subject Expertise Maths - Essential English - Essential Desirable Subject Expertise Science - Desirable Experience teaching GCSE Science would be particularly advantageous. Desirable Qualifications & Experience Qualified Teacher Status (QTS), PGCE or equivalent teaching qualification. SEN/SEND-related qualifications or specialist training. GCSE and/or A-Level teaching experience. Experience supporting learners with EHCPs. Experience working within alternative provision, specialist settings or mainstream schools. Previous experience delivering outreach tuition. Experience supporting learners experiencing school anxiety, EBSA or prolonged absence from education. Why Join Us? This is a rewarding opportunity for an experienced SEN tutor who wants to make a genuine difference to the lives of young people. You will have the opportunity to work closely with individual learners, providing consistent, personalised support that helps them reconnect with education and make progress at their own pace. With ongoing referrals, flexible hours and typical caseloads of 10-15 hours per student per week, the role can offer regular work for tutors who are looking for meaningful outreach opportunities

Qualified Agency Nursery Assistant £17ph + Nursery Agency Worker Job Description Company: Empowering Learning Location: Lewisham Pay Rate: Unqualified: £15.00 per hour Qualified: £17.00 per hour About Us: Empowering Learning is a leading education recruitment agency that specializes in providing high-quality staff to nurseries and schools across the UK. We pride ourselves on our commitment to delivering exceptional service and support to both our candidates and our clients. Role Overview: We are seeking enthusiastic and dedicated Nursery Agency Workers to join our team. This is a flexible role, allowing you to select your preferred days and hours each week. You will be working across various nurseries in your area, providing support and care to children while assisting with daily activities, ensuring their safety, and contributing to their learning and development. Key Responsibilities: Provide high-quality care and support for children aged 0-5 years. Assist with planning and implementing age-appropriate activities to promote development. Supervise and ensure the safety of children at all times. Support children during meal and snack times, and assist with personal care if required. Maintain a clean, safe, and stimulating environment. Work collaboratively with nursery staff and follow the nursery's policies and procedures. Build positive relationships with children, staff, and parents. What We Offer: Competitive hourly rates (£15 unqualified, £17.50 qualified). Flexible working arrangements-choose your days and hours to suit your schedule. Opportunities to gain experience in different nursery settings. Ongoing support and guidance from the Empowering Learning team. Requirements: Experience working with children in a nursery, school, or similar setting. A passion for working with young children and helping them thrive. Good communication skills and a positive attitude. Enhanced DBS check (we can assist you with this if needed). Relevant childcare qualification (for qualified pay rate). Set Your Availability: As a Nursery Agency Worker, you have the flexibility to pick your preferred working days and times. Whether you want to work full-time, part-time, or only specific days, we can accommodate your schedule. How to Apply: If you're interested in joining our team, please contact us at (url removed) with your CV and availability. We look forward to helping you find the perfect balance between work and life while making a positive impact on young children's lives. Empowering Learning is committed to safeguarding and promoting the welfare of children and expects all staff to share this commitment. All roles are subject to an enhanced DBS check. INDELPRI

As a part of the Shopping Partner Engineering, you will serve as the technical bridge between Google and the global commerce ecosystem. You will enable retailers, aggregators, and platforms to integrate with Google's commerce products and surfaces via the Universal Commerce Protocol (UCP), Merchant API, and Google Business Profile API.As a part of this team, you will drive both 0-to-1 incubation and 1-to-N scaling. You will lead early-stage technical pilots, build reference implementations and developer tools, and work closely with Google Engineering and Product teams to harden automated onboarding rails across 35k+ ecosystem integrations. You will act as an advocate of the customer and partner experience, publishing for product and tools improvements backed by data-driven insights. As a Product Technology Manager (Customer and Partner Solutions Engineer role profile), you will partner with Product Managers, Core Engineering, Product Operations Managers, and global partner teams to oversee the technical execution and 0-to-1 pilot incubation of Google's Commerce products.Individual pay is determined by factors including job-related skills, experience, and relevant education or training.Ireland: €90000 - €92000 (EUR) + 15% bonus target + equity + benefitsLearn more about benefits at Google.Minimum qualifications: Bachelor's degree in Engineering, Computer Science, a related field, or equivalent practical experience.3 years of experience in computer engineering, software development, or building technical tools, including writing code to create solutions.3 years of experience in a consulting, partner engineering, or client-facing technical role.3 years of experience in operations management (e.g., process improvement, operational reviews, workflow optimization).Experience with web technologies (HTTP/REST, JSON) and programming in Python, JavaScript/TypeScript, Go, or Java.Experience working with e-commerce platforms, APIs, webhooks, or merchant integration ecosystems.Preferred qualifications: Master's degree in Computer Engineering, Computer Science, or a related technical field, or equivalent practical experience.Experience with APIs, webhooks, and modern programming languages (e.g., Python, TypeScript/JavaScript, Go, Java).Responsibilities: Act as the technical lead for early-stage retailer pilots in EMEA, providing technical guidance, architectural reviews, and integration support.Develop code samples, technical tools, and integration recipes on developers.google.com to expedite partner testing and validation.Provide high-touch technical subject matter expertise, troubleshooting, and issue resolution for strategic retail partners within defined service level agreements.Collaborate closely with Core Engineering and Product Management teams across California, London, and Zurich to test new protocol capabilities and harden specifications.Synthesize pilot edge cases, partner telemetry, and technical feedback to advocate for product and feature improvements backed by data.TPBN1_UKTJ

SEN Tutor - Secondary Outreach (Year 7-GCSE) Location: Bromley Position: SEN Specialist Tutor - 1-to-1 Outreach Tuition Age Range: Secondary - Year 7 to GCSE Subjects: Maths and English essential; Science desirable Hours: 0-40 hours per week (0-hour contract) Typical Referral: 10-15 hours per week per learner Pay Rate: £25-£35 per hour Contract Type: Ongoing / Long-Term Working Hours: Primarily during school hours About the Opportunity We are looking for experienced and compassionate SEN Tutors to provide personalised one-to-one tuition to secondary-aged learners in and around the Bromley area, supporting students from Year 7 through to GCSE. The learners may have additional needs or circumstances that make attending mainstream school difficult. This could include SEND, anxiety, gaps in education, behavioural or emotional needs, or prolonged absence from school. As an outreach tutor, you will provide structured and engaging lessons tailored to the individual learner. The aim is not only to improve academic attainment, but also to help students rebuild confidence, develop positive attitudes towards learning and gradually re-engage with education. Strong secondary-level Maths and English teaching experience is essential. Tutors who can also confidently deliver Science, particularly GCSE Science, will be especially welcomed. Most assignments provide around 10-15 hours of tuition per learner each week, usually during school hours. Sessions may be delivered in the learner's home, a community setting or another appropriate location. Learner Profiles Students may present with a variety of additional needs and barriers to education, including: Autism Spectrum Condition (ASC/ASD) ADHD Dyslexia and dyscalculia Speech and language difficulties SEMH needs School-related anxiety Emotionally Based School Avoidance (EBSA) Extended periods away from mainstream education Gaps in learning and curriculum access difficultiesTutors should be confident adapting their teaching style and creating a calm, consistent and encouraging environment for learners who may have found traditional education challenging. Key Duties Deliver high-quality 1-to-1 tuition to secondary learners from Year 7 through GCSE. Teach Maths and English across the secondary curriculum. Identify learning gaps and respond to individual educational needs. Prepare personalised lesson plans and suitable learning resources. Adapt teaching approaches according to each learner's SEND profile. Support academic development alongside confidence, engagement and independence. Work towards EHCP targets, curriculum objectives and individual learning goals. Provide GCSE preparation where appropriate. Develop positive and trusting relationships with learners. Monitor progress, engagement and achievement throughout the placement. Maintain clear records and provide feedback when required. Communicate appropriately with parents, carers, schools and other professionals. What We're Looking For Successful applicants will ideally have: Strong secondary Maths and English teaching experience. Experience teaching students between Year 7 and GCSE. At least two years' experience working with children or young people with SEN/SEND is preferred. Knowledge of effective strategies for supporting different SEND needs. The ability to engage learners who may be anxious, reluctant or disengaged. A patient, flexible and empathetic teaching style. Excellent communication and relationship-building skills. The confidence to work independently in an outreach setting. Good organisation and lesson-planning skills. An Enhanced DBS on the Update Service, or willingness to obtain one. A genuine commitment to helping young people overcome barriers to education. Subject Requirements Essential: Maths EnglishDesirable: ScienceExperience delivering GCSE Science would be an advantage. Additional Experience That Would Be Beneficial The following qualifications or experience would be advantageous: QTS, PGCE or an equivalent teaching qualification. SEN/SEND qualifications or specialist training. GCSE and/or A-Level teaching experience. Experience working with EHCP targets. Experience in mainstream schools, specialist settings or alternative provision. Previous outreach or home tuition experience. Experience supporting learners with school anxiety, EBSA or prolonged absence. Why Work With Us? This is an opportunity to provide meaningful, individualised educational support to young people who may need a different approach to learning. Rather than working within a traditional classroom environment, you will have the opportunity to focus closely on one learner, adapting your sessions to their needs and helping them make progress both academically and personally. With ongoing referrals and typical placements of 10-15 hours per learner each week, this role can provide regular and rewarding work for tutors who enjoy making a direct difference

SEN Specialist Outreach Tutor - Secondary (Year 7-GCSE) Location: Bromley Position: SEN Specialist Tutor - Outreach Tuition Age Range: Secondary - Year 7 to GCSE Subjects: Maths and English essential; Science desirable Hours: 0-40 hours per week (0-hour contract) Typical Referral: 10-15 hours per week per student Pay Rate: £25-£35 per hour Contract Type: Ongoing / Long-Term Working Hours: Primarily during school hours About the Role We are seeking dedicated and experienced SEN Specialist Tutors to provide personalised, one-to-one outreach tuition to secondary-aged students across Bromley, from Year 7 through to GCSE. This role is ideal for a tutor who is passionate about supporting young people who may be struggling to access mainstream education due to additional learning needs, SEND, school anxiety, or other barriers to education. You will deliver engaging and highly individualised tuition programmes designed to help students re-engage with learning, rebuild confidence, develop essential skills, and make meaningful academic progress. Maths and English teaching experience is essential. The ability to teach Science at secondary level, particularly GCSE, is highly desirable. Most referrals involve approximately 10-15 hours of tuition per student per week, generally delivered during school hours, although flexibility may be required depending on the individual learner and referral. This is an outreach-based role, so tuition may take place in a learner's home, community setting, or another suitable agreed location. About the Students The students you support may have a range of additional needs and barriers to education, including: Autism Spectrum Condition (ASC/ASD) ADHD Dyslexia Dyscalculia Speech and Language Difficulties SEMH (Social, Emotional and Mental Health) needs School anxiety Emotionally Based School Avoidance (EBSA) Previous disengagement from mainstream education Gaps in learning or difficulties accessing the curriculumYou will need to be confident adapting your approach to meet the individual needs of each learner and creating a calm, supportive environment where they can feel safe and successful. Key Responsibilities Deliver high-quality, one-to-one outreach tuition to secondary-aged learners from Year 7 to GCSE. Teach Maths and English confidently across the secondary age range. Assess individual learning needs and identify gaps in knowledge. Plan and deliver structured, personalised learning programmes. Adapt teaching methods and resources to suit different SEND profiles and learning styles. Support learners to work towards their EHCP targets, curriculum objectives and academic goals. Help students prepare for GCSEs and other relevant examinations where appropriate. Build positive, trusting relationships with learners who may have experienced significant barriers to education. Monitor progress and maintain accurate records of learning, engagement and achievement. Provide appropriate feedback and updates to parents, carers, schools and relevant professionals. Work collaboratively with families and other professionals involved in the learner's education. Candidate Requirements We are looking for tutors who have: Strong experience teaching secondary Maths and English. Experience working with students from Year 7 through to GCSE. Previous experience supporting children or young people with SEN/SEND; a minimum of two years' experience is preferred. A strong understanding of different SEND profiles and effective strategies for supporting learners with additional needs. The ability to engage and motivate students who may be anxious, disengaged or reluctant to learn. Excellent communication and relationship-building skills. A patient, adaptable and empathetic approach. The ability to work independently and confidently within an outreach environment. Strong organisational skills and the ability to plan structured, purposeful sessions. An Enhanced DBS registered on the Update Service, or willingness to obtain one. A genuine passion for helping young people overcome barriers to education and achieve their potential. Essential Subject Expertise Maths - Essential English - Essential Desirable Subject Expertise Science - Desirable Experience teaching GCSE Science would be particularly advantageous. Desirable Qualifications & Experience Qualified Teacher Status (QTS), PGCE or equivalent teaching qualification. SEN/SEND-related qualifications or specialist training. GCSE and/or A-Level teaching experience. Experience supporting learners with EHCPs. Experience working within alternative provision, specialist settings or mainstream schools. Previous experience delivering outreach tuition. Experience supporting learners experiencing school anxiety, EBSA or prolonged absence from education. Why Join Us? This is a rewarding opportunity for an experienced SEN tutor who wants to make a genuine difference to the lives of young people. You will have the opportunity to work closely with individual learners, providing consistent, personalised support that helps them reconnect with education and make progress at their own pace. With ongoing referrals, flexible hours and typical caseloads of 10-15 hours per student per week, the role can offer regular work for tutors who are looking for meaningful outreach opportunities. Please feel free to give me a call on : (phone number removed) Or drop me an email at

Early Years Practitioner (CACHE Level 2 or Level 3) Hayes, West London £15.00 per hour Flexible Supply / Bank StaffWe are currently looking for qualified Early Years Practitioners to join our team of bank staff supporting a well-established nursery in Hayes. This is a flexible supply role, ideal for someone looking to pick up additional work around existing commitments or for practitioners seeking regular nursery work without the commitment of a permanent position. The Role Working with children aged 0-5 years Supporting learning and development through play Creating a safe, engaging and nurturing environment Assisting with daily routines, activities and mealtimes Working closely with nursery staff to ensure high standards of care We're Looking For CACHE Level 2 or CACHE Level 3 qualification in Childcare/Early Years (or recognised equivalent) Previous experience working within a nursery or early years setting Good understanding of the EYFS framework A caring, enthusiastic and reliable approach An Enhanced DBS on the Update Service, or willingness to obtain one What's on Offer? £15.00+ per hour Flexible working days to suit your availability Weekly pay Ongoing work available throughout the academic year Support from a dedicated consultantWhether you're looking for one day a week or full-time supply work, we'd love to hear from you. Apply today to find out more. APPLICATION REQUIREMENTS FOR VERITAS EDUCATION All applications are subject to an Enhanced DBS Disclosure, professional reference checks, Overseas Police Clearances (if applicable) in line with our stringent safeguarding policy Your CV must cover the last 10 years of employment history where possible and all employment breaks must be explained You must have legal right to work in the UK You must be willing to attend a registration interviewVeritas Education work with a variety of schools covering a wide geographical area. We deal with teaching placements at Primary, Secondary and college level as well as support staff positions also within these. Disclaimer 'Nothing within the above advert was in any way designed or intended to discriminate on the grounds of age, gender, race, colour, religion, disability or sexual orientation. Veritas Education is an Equal opportunities employer and is proud in the knowledge that all placements are made on merit and suitability. We accept applications from all sections of the community

SEN Specialist Tutor - Bromley Location: Bromley Position: SEN Outreach Tutor - 1-to-1 Tuition Learners: Secondary - Year 7 to GCSE Subjects: Maths & English essential | Science desirable Hours: 0-40 hours per week Typical Referral: 10-15 hours per learner per week Pay: £25-£35 per hour Contract: Ongoing / Long-Term Working Pattern: Mainly during school hours About the Role We are looking for experienced SEN tutors to provide tailored one-to-one tuition to secondary-aged learners in Bromley. The students you will work with may be unable to attend mainstream education due to a range of additional needs or barriers. This could include SEND, anxiety, SEMH needs, disrupted education, school avoidance or significant gaps in their learning. As an outreach tutor, you will provide a flexible and personalised approach to education, adapting your lessons around the individual learner. Your support will help students improve their academic skills while also rebuilding confidence, motivation and engagement with learning. Maths and English teaching experience is essential. Tutors with the ability to deliver secondary or GCSE Science are also encouraged to apply. Most placements offer approximately 10-15 hours of tuition per week per student, generally within school hours. Depending on the referral, tuition may take place at the learner's home, in a community venue or another suitable location. Students You May Support Learners may have a variety of additional needs, including: Autism Spectrum Condition (ASC/ASD) ADHD Dyslexia Dyscalculia Speech and language difficulties SEMH needs School anxiety Emotionally Based School Avoidance (EBSA) Previous or ongoing absence from education Gaps in subject knowledge Difficulties accessing mainstream educationYou should be able to create a positive and low-pressure learning environment and adjust your approach according to each student's individual needs. Your Responsibilities Provide individualised tuition to learners from Year 7 through GCSE. Deliver Maths and English lessons confidently across the secondary curriculum. Assess learning needs and identify areas requiring additional support. Plan purposeful lessons based on individual targets and abilities. Modify resources and teaching methods to accommodate SEND needs. Support learners with EHCP targets and wider educational objectives. Assist with GCSE preparation and examination skills where relevant. Build positive working relationships with students and their families. Encourage confidence, independence and consistent engagement. Monitor learning and record progress throughout the placement. Share appropriate feedback with parents, carers, schools and professionals. Work collaboratively with those involved in the learner's education. Candidate Profile We are seeking tutors who can demonstrate: Strong secondary Maths and English teaching experience. Experience supporting students from Year 7 to GCSE. Previous experience working with children or young people with SEN/SEND. Ideally, two or more years of relevant SEN experience. A good understanding of SEND and differentiated teaching approaches. Experience engaging learners who may be anxious, withdrawn or reluctant to participate. Patience, empathy and the ability to adapt quickly. Strong communication and interpersonal skills. The ability to work independently and professionally. Good organisation and lesson-planning skills. An Enhanced DBS on the Update Service, or willingness to obtain one. Subject Expertise Essential: Maths EnglishDesirable: ScienceGCSE Science teaching experience would be particularly useful. Additional Experience The following would be advantageous: QTS, PGCE or equivalent teaching qualification. SEN/SEND specialist training or qualifications. GCSE and/or A-Level teaching experience. Experience working with EHCPs. Experience in specialist schools, mainstream education or alternative provision. Previous outreach, home tuition or 1-to-1 teaching experience. Experience supporting young people experiencing EBSA, school anxiety or prolonged absence. Why Join? This role offers the opportunity to make a direct and lasting difference to young people who may have struggled within a traditional classroom environment. By providing consistent one-to-one support, you can help learners rebuild their confidence, address gaps in their education and develop the skills they need to progress. With ongoing referrals, flexible hours and typical placements of 10-15 hours per learner each week, this is an excellent opportunity for experienced SEN tutors seeking rewarding outreach work in Bromley

Package: £Negotiable + Bonus + BenefitsLocation: London, UKJob Type: Associate Director, UK / US Personal TaxPosition Type: PermanentHours: Full-timeContact Name: Andy ShawContact Company: JAM Global Mobility RecruitmentThe BackgroundThis leading boutique consultancy is actively seeking and experienced UK / US tax dual handler to strengthen their leadership team in London. Applicants with previous experience dealing with High-Net-Worth Individuals who have dual reporting needs in both the UK and US would be ideal. Applicants will also possess strong leadership skills and an appetite to grow the firms current service offering.The RoleThe UK / US Tax Associate Director will be responsible for but not limited to the following:Leading strategic initiatives and proposals.Caring for your own national and international client portfolio including high net worth individuals, partnerships, and trusts.Maintaining strong industry knowledge including keeping up to date with any relevant changes to the law and the latest trends.Carrying out client satisfaction surveys to ensure high standards are maintained.Assisting with the service delivery of technology tools.Identify up-selling and cross-selling opportunities.Leads develops and nurtures colleagues to support their future growth.The Person:The successful candidate will have previous experience of dealing with both UK & US personal tax and the associated issues. Applicants will be educated to degree level (or equivalent); any additional tax qualifications would be desirable but are not essential.To Apply:Please forward your CV or call Andy Shaw on +44 (0)754 569 7713 or via FaceTime, Skype, WhatsApp or Messenger.In compliance with the new regulations (April 2004) in place under the Employment Agencies Act, JAM Global Mobility will require proof of identification.JAM Recruitment is acting as an employment agency with regards to this position.View our latest jobs today on our website and follow us on Facebook, Twitter & LinkedInTPBN1_UKTJ

At Google, we put our users first. The world is always changing, so we need Product Managers who are continuously adapting and excited to work on products that affect millions of people every day.In this role, you will work cross-functionally to guide products from conception to launch by connecting the technical and business worlds. You can break down complex problems into steps that drive product development.One of the many reasons Google consistently brings innovative, world-changing products to market is because of the collaborative work we do in Product Management. Our team works closely with creative engineers, designers, marketers, etc. to help design and develop technologies that improve access to the world's information. We're responsible for guiding products throughout the execution cycle, focusing specifically on analyzing, positioning, packaging, promoting, and tailoring our solutions to our users.Minimum qualifications: Bachelor's degree or equivalent practical experience.5 years of experience in product management or related technical role.2 years of experience taking technical products from conception to launch (e.g., ideation to execution, end-to-end, 0 to 1, etc.).Experience with Android or iOS mobile application development.Experience defining and delivering developer tools.Preferred qualifications: Master's degree in a technology or business related field.3 years of experience in a business function or role (e.g., marketing, business operations, consulting).3 years of experience in a role preparing and delivering technical presentations to executive leadership.2 years of experience in software development or engineering.2 years of experience working cross-functionally with engineering, UX/UI, sales finance, and other stakeholders.Responsibilities: Own and drive product goal, developer journeys and product roadmap for App Performance, driving projects to evolve our performance story such as AI driven insights.Be a daily user of the tools you own to build Android apps, building empathy and providing feedback.Partner with other cross-functional teams working on performance and work collaboratively with engineering, marketing, legal, UX, DevRel.Evolve our performance story for new agentic development patterns.Develop solutions to problems by collaborating as needed across regions, product areas, and functions.TPBN1_UKTJ

SEN Outreach GCSE Tutor - Bromley Position: SEN Specialist Tutor - Outreach Tuition Age Range: Secondary - Year 7 to GCSE mainly Subjects: Maths and English essential; Science desirable Hours: 0-40 hours per week (0-hour contract) Typical Referral: 10-15 hours per week per student Pay Rate: £25-£35 per hour Contract Type: Ongoing / Long-Term Working Hours: Primarily during school hours About the Role We are seeking dedicated and experienced SEN Specialist Tutors to provide personalised, one-to-one outreach tuition to secondary-aged students across Bromley, from Year 7 through to GCSE. This role is ideal for a tutor who is passionate about supporting young people who may be struggling to access mainstream education due to additional learning needs, SEND, school anxiety, or other barriers to education. You will deliver engaging and highly individualised tuition programmes designed to help students re-engage with learning, rebuild confidence, develop essential skills, and make meaningful academic progress. Maths and English teaching experience is essential. The ability to teach Science at secondary level, particularly GCSE, is highly desirable. Most referrals involve approximately 10-15 hours of tuition per student per week, generally delivered during school hours, although flexibility may be required depending on the individual learner and referral. This is an outreach-based role, so tuition may take place in a learner's home, community setting, or another suitable agreed location. About the Students The students you support may have a range of additional needs and barriers to education, including: Autism Spectrum Condition (ASC/ASD) ADHD Dyslexia Dyscalculia Speech and Language Difficulties SEMH (Social, Emotional and Mental Health) needs School anxiety Emotionally Based School Avoidance (EBSA) Previous disengagement from mainstream education Gaps in learning or difficulties accessing the curriculumYou will need to be confident adapting your approach to meet the individual needs of each learner and creating a calm, supportive environment where they can feel safe and successful. Key Responsibilities Deliver high-quality, one-to-one outreach tuition to secondary-aged learners from Year 7 to GCSE. Teach Maths and English confidently across the secondary age range. Assess individual learning needs and identify gaps in knowledge. Plan and deliver structured, personalised learning programmes. Adapt teaching methods and resources to suit different SEND profiles and learning styles. Support learners to work towards their EHCP targets, curriculum objectives and academic goals. Help students prepare for GCSEs and other relevant examinations where appropriate. Build positive, trusting relationships with learners who may have experienced significant barriers to education. Monitor progress and maintain accurate records of learning, engagement and achievement. Provide appropriate feedback and updates to parents, carers, schools and relevant professionals. Work collaboratively with families and other professionals involved in the learner's education. Candidate Requirements We are looking for tutors who have: Strong experience teaching secondary Maths and English. Experience working with students from Year 7 through to GCSE. Previous experience supporting children or young people with SEN/SEND; a minimum of two years' experience is preferred. A strong understanding of different SEND profiles and effective strategies for supporting learners with additional needs. The ability to engage and motivate students who may be anxious, disengaged or reluctant to learn. Excellent communication and relationship-building skills. A patient, adaptable and empathetic approach. The ability to work independently and confidently within an outreach environment. Strong organisational skills and the ability to plan structured, purposeful sessions. An Enhanced DBS registered on the Update Service, or willingness to obtain one. A genuine passion for helping young people overcome barriers to education and achieve their potential. Essential Subject Expertise Maths - Essential English - Essential Desirable Subject Expertise Science - Desirable Experience teaching GCSE Science would be particularly advantageous. Desirable Qualifications & Experience Qualified Teacher Status (QTS), PGCE or equivalent teaching qualification. SEN/SEND-related qualifications or specialist training. GCSE and/or A-Level teaching experience. Experience supporting learners with EHCPs. Experience working within alternative provision, specialist settings or mainstream schools. Previous experience delivering outreach tuition. Experience supporting learners experiencing school anxiety, EBSA or prolonged absence from education. Why Join Us? This is a rewarding opportunity for an experienced SEN tutor who wants to make a genuine difference to the lives of young people. You will have the opportunity to work closely with individual learners, providing consistent, personalised support that helps them reconnect with education and make progress at their own pace. With ongoing referrals, flexible hours and typical caseloads of 10-15 hours per student per week, the role can offer regular work for tutors who are looking for meaningful outreach opportunities

Recruitment Consultant – Engineering, Housing & Construction Bromley (office-based, Monday–Friday) Delivery Consultant: £25K–£32K | Senior Consultant: £32K–£38K + uncapped commission The Company A leading specialist recruitment business, backed by a successful group with multiple high-performing recruitment brands. The business has built a strong reputation across the engineering, housing, and construction markets, working with some of the UK’s most recognised names in the energy and renewables sectors. With over 250 live roles at any given time and continuous demand from major clients, the business is now expanding its team and looking for experienced recruiters to join its growing Bromley office. The Opportunity We’re recruiting across two levels: Delivery Consultants (£25K–£32K) – focusing on candidate resourcing, delivery, and relationship management. Senior Consultants (£32K–£38K) – full 360 responsibility with scope to manage and grow key client accounts. Why Join? Established client base, including the UK’s largest energy provider Over 130 live vacancies with one client alone High-value temps desks with 30+ active runners Top billers generating £30K–£40K in monthly revenue Blend of blue- and white-collar recruitment across energy, gas, electrical, and renewables Commission Structure (uncapped): £0–£10K = 10% £10K–£20K = 20% £20K–£30K = 30% £30K+ = 35% (Top performers consistently achieve the highest bracket.) Perks & Incentives High achievers’ trips (Ibiza, Vegas and more) Quarterly lunch clubs Free parking within walking distance of the office Clear career progression into 360 roles and leadership What We’re Looking For Experienced recruiters with a strong billing or delivery background Temps or perms experience (sector background flexible) Driven, resilient, and motivated individuals who thrive in a fast-paced environment * Fully office-based, 5 days per week This is a chance to join a market-leading recruitment business with a wealth of live vacancies, outstanding earning potential, and the backing of a successful group. Apply today to fast-track your recruitment career with a high-growth, ambitious team

Qualified Nursery Practitioner – Flexible Work Available Beyond Education Recruitment is seeking qualified Nursery Practitioners, Early Years Practitioners and Nursery Nurses to work in local nursery settings. As a Qualified Nursery Practitioner, you will support children aged 0–4 years, working alongside nursery staff to provide a safe, caring and stimulating environment. You will help promote children’s learning and development in line with the EYFS. Key responsibilities include: Supporting children’s learning and development Leading and supporting play-based activities Arts, crafts, messy play, singing and storytelling Supervising indoor and outdoor play Supporting feeding and toileting when required Maintaining a safe and nurturing environment Working as part of a professional nursery team Requirements: Level 2 or Level 3 qualification in Childcare, Early Years, EYFS, Nursery Practice or Nursery Nursing Previous nursery or early years experience preferred Enhanced DBS or willingness to obtain one * Reliable, professional and passionate about working with children What we offer: Flexible Monday–Friday work, competitive pay, regular local opportunities, temp-to-perm positions and an Employee of the Month bonus. Work Location: In person

Qualified Nursery Practitioner Level 2/3 Location: Croydon (West Wickham) Salary: £28,500.to £31,075. Contract: Full-time, Permanent, We are recruiting on behalf of our client who is looking for a fantastic full-time Nursery Practitioner opportunity available for an enthusiastic and versatile Level 2 or Level 3 qualified practitioner in our nursery in Croydon. Responsibilities: of the Level 2/3 Nursery Practitioner: To act as a key worker and provide care for a small group of children Using your knowledge of the EYFS, help plan daily activities and provide suitable play and learning opportunities To write learning journeys for your key children and contribute to room planning To ensure children develop and learn in a safe, stimulating and supportive environment To monitor children’s progress and share information about their development with parents and carers To carry out all duties associated with caring for your key group and supporting the daily nursery routine What we’re looking for: Level 2 or Level 3 Childcare Qualification (required) Experience is essential working with children aged 0-5 Strong knowledge of the EYFS framework and safeguarding practices Excellent communication skills with children, parents, and colleagues A warm, nurturing approach with a genuine love for supporting children’s development Previous experience working in an early years setting The right to work in the UK What we offer: A supportive, welcoming team environment Ongoing professional development and training opportunities for a Nursery Practitioner Competitive salary (based on experience and qualifications) Opportunities for career progression All successful applicants will be required to complete an enhanced DBS check, join the DBS Update Service and provide two suitable references confirming their suitability to work with children. Apply today email your most up-to-date CV. Plus Staff Recruitment is a specialist Early Years and Education Recruitment Company working with Nurseries and Primary Schools settings across London, Kent and Surrey. We respect candidate confidentiality and will not share your profile to our clients or request any references without your consent. We cater for all Early Years jobs and currently have Nursery Manager, Deputy Manager, QTS, Montessori, Room Leader and Early Years Practitioner / Nursery Nurse vacancies Plus Staff Recruitment are an Equal Opportunities Employer

A leading international transport and infrastructure organisation is seeking an experienced Paralegal to join its in-house legal team on an initial 6-month fixed-term contract. You will be an experienced Paralegal (ideally at least 2 years' relevant experience/0, ideally gained within an in-house le

Risk and Compliance Lawyer Stand-out US law firm is hiring a new Risk and Compliance Lawyer / Attorney to join their expanding General Counsel department. This role is offering a fantastic salary and the firm offer amazing benefits - including free breakfast, lunch, dinner, coffees - like being at a 5 star hotel! What's on Offer: • Hybrid Working - 4 days office / 1 day remote (Friday), • Growing Team, • Highly generous and competitive salary, • Amazing Benefits, • Minimum 1 to 4 years legal experience in a fast-paced environment. Risk and Compliance Lawyer / Attorney - What you'll be doing (will include but not limited to): • Keeping abreast of relevant regulatory and compliance changes/developments and monitoring how this will affect firm policy;, • Advising on policy changes that will need to take place in line with regulatory developments and changes in law as required and draft amendments to such policies;, • Support with training for the firm and team;, • Working closely with the firm's Director of European Risk and Compliance on risk and compliance projects;, • Supervising junior members of the risk and compliance team and offering guidance as appropriate;, • Working with key stakeholders and acting as a representative for the firm's compliance function at events;, • Supporting the firm with general risk and compliance queries;, • Liaising with the COLP as appropriate;, • Assisting with data privacy and appropriate analysis as it relates to work of the OGC. Risk and Compliance Lawyer / Attorney - What we are looking for: • Bachelor's degree required (2:1 or above preferred);, • Essential: Qualified Solicitor (England & Wales) 0-4 PQE;, • Previous experience within a compliance team is desirable;, • Fee earners with regulatory experience who are considering their first role within a Risk and Compliance team will also be welcomed;, • A very high level of attention to detail;, • Excellent analytical skills; #J-18808-Ljbffr

We are seeking an experienced Head of Commissioning to provide strategic leadership across SEND commissioning, sufficiency planning and market development for children and young people aged 0-25. You will lead the development and delivery of the Council's SEND commissioning and sufficiency strategies, using demographic, EHCP and placement data to forecast future demand and ensure the right provision is available locally. A key focus will be on developing the local SEND market and reducing reliance on independent and out-of-area placements. You will oversee the full commissioning cycle, from needs analysis and market engagement through to procurement, contract management and evaluation. You will also work closely with schools, education providers, Health, Social Care, Integrated Care Boards and families to develop effective and integrated services. You will also lead the commissioning elements of the SEND Post Inspection Action Plan, supporting wider improvement and transformation across SEND services. You will have proven experience in: • SEND sufficiency planning and market development, • Managing High Needs Block budgets, • Commissioning services and managing contracts, • Developing local specialist SEND provision, • Strategic partnership working across education, health and social care, • Leading complex change and service transformation You will have strong knowledge of the Children and Families Act 2014, SEND Code of Practice, High Needs funding, school place planning and public-sector commissioning and procurement. Experience of the Ofsted/CQC Area SEND inspection framework and leading improvement activity would also be highly valuable. • Day Rate: £600 p/d umbrella, • Location: London / Hybrid, • Start: ASAP #J-18808-Ljbffr

Reporting to the Head of Ortho UK this role is a leadership role managing a defined region to achieve the overall Sales Goals within defined timescales and parameters. This will include providing overall direction to their Territory Manager Direct Reports, in line with the overall strate-gies and plans of the UK and wider Global organization mission and values; through engagement, development and coaching. • Liaise with marketing and Head of Ortho regarding market potential within the assigned Region, preparing and implementing sales forecasts as required. Propose and implement action plans, which ensure that the sales goals are attained or exceeded., • Identify and develop key relationships within Region, ensuring ClearCorrect is top of mind for each account, working to support the team to grow existing customers and acquire new customers in a strategically profitable manner., • Supervise and evaluate activities of assigned Territory Managers, Clinical Advisors and Customer Success Managers providing leadership, coaching , guidance and feedback to achieve the established objectives of the region. This includes co-travelling with direct reports., • Liaise with leadership across the organization, particularly the other managers of other business units as well as Marketing & Education, Customer Services & Finance to ensure that sales objectives and activities are integrated with other parts of the business., • Interpret, implement and ensure compliance of Sales strategies and tactics, ensuring le-gal practices and ISO 9001 quality assurance practices are followed., • Review and analyse data on Salesforce.com, reporting to the Head of Ortho any product issues, loss or potential loss of key customers, or competitive sales strategies, which negative-ly or positively affect Regional sales. Advise about and ensure corrective action is implement-ed., • Conduct regular meetings to ensure constant communication and consistent application of company sales strategy, policies, etc with Regional Sales Team to respond to Regional and wider UK issues., • Maintain and grow business with customers in the region to ensure that new techniques and digital workflows are front of mind with the team and the customers., • Responsible in collaboration with HR for leadership, recruitment, selection, development and performance management of direct reports., • Responsible for the design, implementation and compliance of local sales budgets within the allocated expense budget. Monitoring the cost and effectiveness of sales activities to op-timise resources and prioritise spending., • Work with Territory Managers on their major prospects, potential customers, major key customers to help them build their business through actively engaging their businesses, under-standing their business drivers and proposing realistic, tailored Straumann business solutions to improve the customer’s overall business profitability., • Identify opportunities including the creation of leads for the broader group portfolio espe-cially within the DSO space., • Preferably degree educated or equivalent., • Significant sales/commercial leadership experience (5 years +)., • Ability to extract and interpret data – experience of SFDC an advantage., • Experience of providing innovative, thought provoking solutions to business issues and a consultative sales approach., • Experience of Dental/Medical Device market desirable., • Strong emotional intelligence and self-awareness., • Flexible working style with ability to adopt situational leadership., • Ability to inspire motivate and guide a team., • Resilience and determination., • Integrity and accountability. All information will be treated confidentially in line with EEO / GDPR regulations. The Straumann Group is an equal opportunity employer and values diversity in all its forms. We are committed to building a culture of inclusion that reflects the patients and professionals we serve. At ClearCorrect, we’re not just straightening smiles—we’re opening doors to broader treatment solutions and long-term practice growth. All qualified applicants will receive consideration for employment without regard to race, color, religion, sex, sexual orientation, gender identity, national origin, or disability. Employment Type: Full Time • United Kingdom : Aberdeen City, • United Kingdom : Aberdeenshire, • United Kingdom : Angus, • United Kingdom : Antrim and Newtownabbey, • United Kingdom : Ards and North Down, • United Kingdom : Argyll and Bute, • United Kingdom : Armagh Banbridge and Craigavon, • United Kingdom : Barking and Dagenham, • United Kingdom : Barnet, • United Kingdom : Barnsley, • United Kingdom : Bath and North East Somerset, • United Kingdom : Bedford, • United Kingdom : Belfast, • United Kingdom : Bexley, • United Kingdom : Birmingham, • United Kingdom : Blackburn with Darwen, • United Kingdom : Blackpool, • United Kingdom : Blaenau Gwent, • United Kingdom : Bolton, • United Kingdom : Bournemouth, • United Kingdom : Bracknell Forest, • United Kingdom : Bradford, • United Kingdom : Brent, • United Kingdom : Bridgend, • United Kingdom : Brighton and Hove, • United Kingdom : Bristol, • United Kingdom : Bromley, • United Kingdom : Buckinghamshire, • United Kingdom : Bury, • United Kingdom : Caerphilly, • United Kingdom : Calderdale, • United Kingdom : Cambridgeshire, • United Kingdom : Camden, • United Kingdom : Cardiff, • United Kingdom : Carmarthenshire, • United Kingdom : Causeway Coast and Glens, • United Kingdom : Central Bedfordshire, • United Kingdom : Ceredigion, • United Kingdom : Cheshire East, • United Kingdom : Cheshire West and Chester, • United Kingdom : Clackmannanshire, • United Kingdom : Conwy, • United Kingdom : Cornwall, • United Kingdom : Coventry, • United Kingdom : Crawley, • United Kingdom : Croydon, • United Kingdom : Cumbria, • United Kingdom : Darlington, • United Kingdom : Denbighshire, • United Kingdom : Derby, • United Kingdom : Derbyshire, • United Kingdom : Derry and Strabane, • United Kingdom : Devon, • United Kingdom : Doncaster, • United Kingdom : Dorset, • United Kingdom : Dudley, • United Kingdom : Dumfries and Galloway, • United Kingdom : Dundee City, • United Kingdom : Durham County, • United Kingdom : Ealing, • United Kingdom : East Ayrshire, • United Kingdom : East Dunbartonshire, • United Kingdom : East Lothian, • United Kingdom : East Renfrewshire, • United Kingdom : East Riding of Yorkshire, • United Kingdom : East Sussex, • United Kingdom : Edinburgh, • United Kingdom : Eilean Siar, • United Kingdom : Enfield, • United Kingdom : Essex, • United Kingdom : Falkirk, • United Kingdom : Fermanagh and Omagh, • United Kingdom : Fife, • United Kingdom : Flintshire, • United Kingdom : Gateshead, • United Kingdom : Glasgow City, • United Kingdom : Gloucestershire, • United Kingdom : Greenwich, • United Kingdom : Gwynedd, • United Kingdom : Hackney, • United Kingdom : Halton, • United Kingdom : Hammersmith and Fulham, • United Kingdom : Hampshire, • United Kingdom : Haringey, • United Kingdom : Harrow, • United Kingdom : Hartlepool, • United Kingdom : Havering, • United Kingdom : Herefordshire, • United Kingdom : Hertfordshire, • United Kingdom : Highland, • United Kingdom : Hillingdon, • United Kingdom : Hounslow, • United Kingdom : Inverclyde, • United Kingdom : Isle of Anglesey, • United Kingdom : Isle of Wight, • United Kingdom : Isles of Scilly, • United Kingdom : Islington, • United Kingdom : Kensington and Chelsea, • United Kingdom : Kent, • United Kingdom : Kingston upon Hull, • United Kingdom : Kingston upon Thames, • United Kingdom : Kirklees, • United Kingdom : Knowsley, • United Kingdom : Lambeth, • United Kingdom : Lancashire, • United Kingdom : Leeds, • United Kingdom : Leicester, • United Kingdom : Leicestershire, • United Kingdom : Lewisham, • United Kingdom : Lincolnshire, • United Kingdom : Lisburn and Castlereagh, • United Kingdom : Liverpool, • United Kingdom : London, • United Kingdom : Luton, • United Kingdom : Manchester, • United Kingdom : Medway, • United Kingdom : Merthyr Tydfil, • United Kingdom : Merton, • United Kingdom : Mid Ulster, • United Kingdom : Mid and East Antrim, • United Kingdom : Middlesbrough, • United Kingdom : Midlothian, • United Kingdom : Milton Keynes, • United Kingdom : Monmouthshire, • United Kingdom : Moray, • United Kingdom : Neath Port Talbot, • United Kingdom : Newcastle upon Tyne, • United Kingdom : Newham, • United Kingdom : Newport, • United Kingdom : Newry/ Mourne and Down, • United Kingdom : Norfolk, • United Kingdom : North Ayrshire, • United Kingdom : North East Lincolnshire, • United Kingdom : North Lanarkshire, • United Kingdom : North Lincolnshire, • United Kingdom : North Somerset, • United Kingdom : North Tyneside, • United Kingdom : North Yorkshire, • United Kingdom : Northamptonshire, • United Kingdom : Northumberland, • United Kingdom : Nottingham, • United Kingdom : Nottinghamshire, • United Kingdom : Oldham, • United Kingdom : Orkney Islands, • United Kingdom : Oxfordshire, • United Kingdom : Pembrokeshire, • United Kingdom : Perth and Kinross, • United Kingdom : Peterborough, • United Kingdom : Plymouth, • United Kingdom : Poole, • United Kingdom : Portsmouth, • United Kingdom : Powys, • United Kingdom : Reading, • United Kingdom : Redbridge, • United Kingdom : Redcar and Cleveland, • United Kingdom : Renfrewshire, • United Kingdom : Rhondda/ Cynon/ Taff, • United Kingdom : Richmond upon Thames, • United Kingdom : Rochdale, • United Kingdom : Rotherham, • United Kingdom : Rutland, • United Kingdom : Saint Helens !St. Helens, • United Kingdom : Salford, • United Kingdom : Sandwell, • United Kingdom : Scottish Borders, • United Kingdom : Sefton, • United Kingdom : Sheffield, • United Kingdom : Shetland Islands, • United Kingdom : Shropshire, • United Kingdom : Slough, • United Kingdom : Solihull, • United Kingdom : Somerset, • United Kingdom : South Ayrshire, • United Kingdom : South Gloucestershire, • United Kingdom : South Lanarkshire, • United Kingdom : South Tyneside, • United Kingdom : Southampton, • United Kingdom : Southend-on-Sea, • United Kingdom : Southwark, • United Kingdom : Staffordshire, • United Kingdom : Stirling, • United Kingdom : Stockport, • United Kingdom : Stockton-on-Tees, • United Kingdom : Stoke-on-Trent, • United Kingdom : Suffolk, • United Kingdom : Sunderland, • United Kingdom : Surrey, • United Kingdom : Sutton, • United Kingdom : Swansea, • United Kingdom : Swindon, • United Kingdom : Tameside, • United Kingdom : Telford and Wrekin, • United Kingdom : Thurrock, • United Kingdom : Torbay, • United Kingdom : Torfaen, • United Kingdom : Tower Hamlets, • United Kingdom : Trafford, • United Kingdom : Vale of Glamorgan, • United Kingdom : Wakefield, • United Kingdom : Walsall, • United Kingdom : Waltham Forest, • United Kingdom : Wandsworth, • United Kingdom : Warrington, • United Kingdom : Warwickshire, • United Kingdom : West Berkshire, • United Kingdom : West Dunbartonshire, • United Kingdom : West Lothian, • United Kingdom : West Sussex, • United Kingdom : Westminster, • United Kingdom : Wigan, • United Kingdom : Wiltshire, • United Kingdom : Windsor and Maidenhead, • United Kingdom : Wirral, • United Kingdom : Wokingham, • United Kingdom : Wolverhampton, • United Kingdom : Worcestershire, • United Kingdom : Wrexham, • United Kingdom : York Travel Percentage: 0 - 100% Requisition ID: 21935 #J-18808-Ljbffr

Location: Our offices are in Central London, along with several of our customers. Travel to our customer sites is required, the frequency of which will vary from customer-to-customer. You need to be able to travel onsite to London up to 3 days per week, although onsite requirements will vary week-to-week and customer-to-customer from 0 to 3 days. Salary: Competitive (DOE) Defence/SC Clearance Requirements: SC clearance is required for our customer facing teams. You do not need active SC clearance as we will undertake checks upon you joining, but you must be eligible to pass SC clearance. DV clearance may be required for certain roles, so the ability/willingness to pass DV clearance is advantageous but not essential. We are hiring a Head of Migrations to lead all migration work across the business. You will be the single accountable owner of our migration pipeline, created in direct response to the volume of AWS Migration Acceleration Programme (MAP) engagements now running across our client base. The remit goes wider than MAP workload migrations. You will lead data centre exit programmes and landing zone migrations too, building a repeatable set of methodologies and delivery assets for each rather than running every engagement bespoke. This is a role that grows with the offering. You start by proving demand and defining how we deliver. Once the investment case lands, you recruit and lead the team. In time you own a standalone unit with full profit and loss accountability. The person does not change as the offering matures. What changes is what you are accountable for. • Own Cloudscaler’s MAP relationship, making sure engagements are registered, funded and tracked through Assess, Mobilise and Migrate, with funding claims that are accurate, evidenced and defensible., • Lead data centre exit programmes end to end, from estate discovery and dependency mapping through to decommissioning and contract exit., • Own our end-to-end migration methodology: portfolio discovery, application assessment using the 7 Rs, wave planning, execution and post-migration validation., • Own the migration assessment tooling as subject‑matter expert, defining what it captures, how findings map to migration patterns, and how a business case is built from the output., • Support the commercial team on proposals, workshops and MAP funding conversations, and build trusted adviser relationships with client CTOs and infrastructure leads., • Deliver against a six-month revenue plan, report monthly KPIs from month one, and build the investment case for a ring-fenced team., • Recruit, lead and develop that team once the case is approved, working to a team gross profit model., • Drive AI and automation across the migration lifecycle to cut manual effort and improve the accuracy of migration business cases., • Represent Cloudscaler publicly through speaking, blogs, white papers and partnership activity with AWS., • Proven leadership of large-scale AWS migration programmes, with real accountability for outcomes., • Working knowledge of AWS MAP, including funding, credits and the evidencing discipline the programme demands., • Experience of data centre exit and landing zone migration, not just application moves., • The ability to build a TCO model and a migration business case that convinces both an architect and a board., • Commercial fluency: revenue, gross profit, utilisation and pipeline are part of the job, not someone else’s problem., • Credibility with senior client stakeholders and a track record of building trust through delivery., • Experience hiring and leading delivery teams, and setting the standard for quality., • Comfort working without an established playbook. You will write it., • Taking an organisation through AWS competency attainment., • Regulated sector experience: financial services, public sector, utilities, healthcare or defence., • Modernisation delivery, including containerisation and server-less refactoring., • P&L ownership for a practice or business unit., • Productising delivery assets into reusable, versioned intellectual property., • Hands-on use of AI tooling to accelerate discovery, assessment and reporting., • Discretionary bonus, • Discretionary security clearance bonus for those holding certain clearance, • Periodic offer of share options schemes, • 25 days’ annual leave, • 5 additional days per year towards training, certifications, or charity work, • Option to buy additional annual leave up to 5 days per year, • Public holidays opt-out scheme, the option to work on public holidays creating the flexibility to enjoy your time off when it suits you, • Certifications and training expensed, • Life Assurance, • Long Term Disability cover, • Employee Assist Programme for employee advice and support (including legal and counselling helpline), • Health, Mental Health, Wellbeing, Financial and Legal support, • 24/7 GP access, • Pension auto‑enrolment and contribution, • Employee referral scheme, • Client referral scheme, • Cycle to work scheme, • Travel expenses policy, • Chat with Talent Team, • Remote interview with Hiring Manager, • Technical interview (remote), • Final in‑person with Leadership Team Cloudscaler are proud to be an equal opportunity employer, committed to equal opportunities regardless of gender identity, sexual orientation, race, ancestry, age, marital status, disability, parental status, religion or medical history. If you require reasonable adjustments during the recruitment process or within the workplace, please let us know when you speak to our Talent Acquisition team or contact talent@cloudscaler.com at the earliest opportunity. #J-18808-Ljbffr

We unlock organisational impact by building the skills, performance, and leadership pipeline that powers the business forward. You will be an integral part of the RELX Talent and Capability (T&C) COE Leadership Team. In this role, you will serve as the Head Talent Partner to the RX business and HR leadership team. You'll take ownership of the delivery of the T&C COE strategy and ensure alignment with divisional priorities to enhance capability and performance. You will also represent the COE on your divisional HR leadership team and ensure talent solutions and development initiatives are effectively integrated into business goals and performance. • Collaborating with a variety of internal stakeholders to identify and implement Talent and Capability approaches that support RX’s business objectives, • Demonstrate commercial acumen and able to articulate the breadth and depth of RX businesses and key commercial drivers, • Advocating and implementing RELX leadership and development programs within RX focusing on elevating manager capability, shaping high-performance RX culture, building a strong talent pipeline of future leaders, • Representing the needs and interests of RX in RELX-wide T&C discussions and initiatives., • Ensuring that final outcomes are relevant, accessible and high-value with a compelling RX narrative, • Promoting a culture of continuous growth and curiosity., • Utilizing data and metrics to monitor the quality, effectiveness and overall user experiences of talent initiatives within RX, • Co-ordinating all activities for RELX Talent Review with business leaders and HR partners to identify critical positions, talent readiness and succession pipelines., • With leaders, support strategies to address readiness gaps, both technical and behavioural thus enhancing purposeful careers, • Driving a culture of feedback and recognition to drive business outcomes and a meaningful employee experience., • Work closely with colleagues across the global HR organization to ensure integrated and aligned approaches for employees and leaders, • Managing the overall divisional training plan, being accountable for categories 1 & 2 budget and monitoring category 3 - non T&C training spend, • Identifying opportunities to drive high volume administrative and autonomous tasks to Tier 0 and 1 support, • Recognise and incorporate the voice of the business when designing, delivering, and embedding talent practices within RX Advocate, educate, and influence senior leaders across various expertise areas within T&C scope., • Focus on business transformation and people-centric approaches., • Operate and lead across different geographies and industries, ensuring successful delivery of large-scale, highly visible talent initiatives, • Maintain a client‑centric approach, adept at building relationships with executive and senior leadership teams, cross‑functional teams, and critical stakeholders, • Understand and interpret RX business challenges and opportunities, prioritising and aligning T&C support accordingly, • Being future‑focused, recognising the impact of AI and other global trends on our work and roles, and partnering with HR leadership and business stakeholders to identify the upskilling and shifts in focus that may be required in response, • Thoughtfully engage in outcome‑focused conversations, bridging T&C solutions with the culture, performance and objectives of the business, • Apply critical strategic and commercial thinking to continuously improve performance in the role and be recognised as a thought partner to senior leadership team, • Maintain an enterprise‑wide perspective on divisional activities while representing a strategic COE position thoughtfully, resolving differences for shared positive outcomes, • Ability to prioritize and manage multiple initiatives, • Demonstrate an educational background that reflects cognitive ability, a commitment to personal development, and lead with curiosity, integrity, and strong personal resilience, • Bachelor’s Degree (Master’s Degree preferred) in a relevant field such as Human Resources, Business Administration, Organisational Development, • 10+ years of progressive experience in talent management, performance management and organisational development, • Proven track record of developing and implementing successful talent strategies, • Effective leadership and team collaboration skills, • Working knowledge and experience with Workday, • We know your well‑being and happiness are key to a long and successful career., • We are delighted to offer country specific benefits. We are an equal opportunity employer: qualified applicants are considered for and treated during employment without regard to race, color, creed, religion, sex, national origin, citizenship status, disability status, protected veteran status, age, marital status, sexual orientation, gender identity, genetic information, or any other characteristic protected by law. USA Job Seekers: EEO Know Your Rights. RX is in the business of building businesses for individuals, communities and organizations. We elevate the power of face‑to‑face events by combining data and digital solutions to help customers learn about markets, source products and complete transactions at over 350 events in 25 countries across 42 industry sectors. RX is passionate about making a positive impact on society and is fully committed to creating an inclusive work environment for all our people. RX is part of RELX, a global provider of information-based analytics and decision tools for professional and business customers. #J-18808-Ljbffr

Looking to race into your next challenge? Strap in, we're looking for a Senior Premium Experience Manager (FTC) to join our unique mission! Formula E, the world's fastest-growing sport, is redefining motorsport with a bold focus on innovation and sustainability. Hosting over 150 races in iconic cities globally and backed by top manufacturers like Porsche, Nissan and Jaguar, we feature elite drivers and cutting-edge EV technology. As the world's first certified B Corp sport and the first sport certified to the British Standards Institution (BSI) Net Zero Pathway. Formula E combines thrilling entertainment with a mission to advance sustainable progress, inspiring a global fanbase with our high-performance brand new GEN4 car capable of hitting speeds of 335kph and reaching 200kph in just 4.4 seconds. Currently achieving 0-100 kmh in 1.8 seconds. Using the spectacle of sport, we are sending a powerful and meaningful message to help alter perceptions and speed-up the switch to electric mobility. As the Senior Premium Experience Manager - Off Track, you will be the driving force behind Formula E's off-track event strategy, taking charge of our premium experience pipeline to transform concepts into world-class, high-impact event activations. Focusing heavily on flagship occasions like the Monaco Gala alongside commercial and marketing deliverables across our global calendar, you will master the art of guest experience, operational precision, and commercial strategy to elevate partner value and fan engagement. In this role, you will also line manage and coach the Off-Track Team and support live race weekend operations with seamless execution directly across international event sites. • Flagship & Commercial Event Delivery: Strategic planning, development, and execution of flagship events including the Monaco Gala, End of Season Awards, car launches, and conferences, alongside commercial and marketing activations across the global calendar., • Operational & Strategic Leadership: Oversee race-week track activities and side events, ensuring best-in-class guest experiences, proactive project management, and seamless cross-functional alignment with C-Suite, Marketing, Commercial, and Sporting teams., • Financial & Commercial Management: Own and manage multiple event budgets and P&Ls, driving revenue opportunities, monitoring cost control, managing PO approvals, and supporting contract negotiations., • Team Management & On-Site Support: Line manage and coach the Off-Track Team, manage international supplier and agency relationships, and serve as the senior escalation point for live event operations. This is a fixed term vacancy until the end of July 2027. • Proven Track Record: Solid experience leading complex, large-scale international events, premium hospitality, or live sports and entertainment experiences, with a proven ability to balance strategic planning with operational excellence., • Commercial & Financial Acumen: Hands-on expertise managing multi-event budgets and P&Ls, maintaining profit margins, negotiating with global suppliers, and maximizing value for commercial stakeholders., • Inspirational Leadership & Stakeholder Savvy: Demonstrated ability to manage and coach a team while comfortably engaging, influencing, and building relationships with C-suite executives, VIP guests, and external partners., • Resilient & Growth Mindset: Exceptional problem-solving skills under pressure in fast-paced environments, combined with a passion for continuous improvement, innovation, and extensive international travel., • 25 days' annual leave, Birthday day off and Wellbeing leave, • Opportunity to extend your stay if travelling for a race event, • Health Cash Plan and access to the Aviva Digital Workplace app, • Enhanced Parental Leave, • Flexible Bank Holidays, • Paid volunteer and carer's leave, • Cycle to Work and Electric Car Scheme, • Formula E store discount, • Regular social events and employee working groups This is a hybrid role and you'll be required to do 3 days a week in our Hammersmith London office The closing date for this role is 23rd September, however if we receive a high volume of applications we may close it early. At Formula E, we are building a culture where every voice matters, every perspective accelerates progress, and every individual is empowered to rise, contribute boldly, and shape a better world - together. We will provide equal opportunities regardless of an individuals' protected characteristics. We believe in attracting and retaining diverse talent to strengthen our global vision with a variety of experiences, backgrounds and perspectives. Our mission is clear. The message is simple. Whoever you are. However you live. Whatever you believe. Formula E. For the Future. For Everyone. We'll see you at the starting line! ¡VAMOS! #J-18808-Ljbffr

Job Title Senior Network Engineer Job Description About IG Group IG Group is a FTSE 100 fintech operating across five continents, serving over 1.4m customers and handling billions of dollars in transactions – built on scale, trust, and proof. We didn't pivot to innovation; it's how we've always operated. What that means for the people who work here is real: genuinely complex problems to solve, the technology and resources to tackle them properly, and the kind of scope that's rare in established businesses. The bar is high – bring a curious and forward-thinking mindset and we'll give you the platform to define what comes next. Join us at IG – the future gets built here. As a Senior Network Engineer, you will play a key role in building and enhancing the infrastructure that powers our fast-growing retail brokerage business, while also supporting a variety of other business initiatives. We are passionate about maintaining the speed, stability, and performance of our back-end systems, which directly impacts the experience of our client-facing applications. Our architecture is constantly evolving to meet new technical challenges, but always with a focus on practicality, performance, and scalability. The IG family of companies is committed to empowering individual investors and traders by providing educational media, intuitive and powerful trading software, high-speed order execution, competitive pricing, and innovative financial products. Our engineers have access to a wide range of tools and technologies, offering the opportunity to tackle diverse problems while honing expertise in specific areas. We are looking for self-motivated, engineering-driven professionals who are pragmatic, enjoy working in a fast-paced environment, and take pride in creating and operating large-scale, highly available, high-performance systems. With a lean team and a management philosophy that values autonomy, you’ll have the freedom to shape impactful solutions. In this role, you'll ensure the reliability and efficiency of IG’s network infrastructure by staying ahead of evolving networking technologies, proactively identifying potential issues, and leading multiple tasks and projects. Our goal is to maintain the most stable, performant network possible to deliver the best experience for our customers. This position is based in our London headquarters. • Act as the technical lead for the enhancement of our data center facilities, ensuring seamless network integration and standardisation across IG., • Lead Networks in the design, implementation, and operation of containerisation and public cloud platforms., • Work collaboratively within the wider network team to design, implement, and manage the groups network infrastructure, ensuring it meets business demands for availability and performance., • Leverage automation technologies and adopt a DevOps style approach to enhance the efficiency, security, and resiliency of the network environment., • Partner closely with the development team to deliver enhanced services and features that drive value for our customers., • Mentor and coach engineers, fostering a culture of learning, growth, and technical excellence within the team., • Maintain comprehensive and up-to-date network documentation and diagrams, creating new materials where necessary to ensure clarity and consistency., • 10+ years of experience in a Senior Network Engineering role, with demonstrable expertise in managing medium to large-scale network infrastructures., • Advanced knowledge of routing and switching concepts, with hands-on experience in managing complex network environments., • In-depth understanding of the TCP/IP stack and experience with a broad range of networking hardware and software, including Switches, Routers, Firewalls, IPS/IDS, and Linux., • Extensive experience working with protocols such as BGP, VxLAN, and vPCs, with a proven history of managing mission-critical production network infrastructure., • Strong working knowledge of enterprise DNS platforms (e.g. Infoblox), including DNS architecture, DHCP/IPAM integration, and DNS security (RPZ/DFP)., • Proven hands‑on experience with Arista Campus and Data Centre platforms, including AGNI (network access control/policy) and CVaaS for network telemetry and lifecycle management., • Familiarity with F5 platforms (LTM/AFM) is advantageous, to support continuity of existing application delivery infrastructure., • Ability to respond quickly and effectively to high‑pressure incidents, maintaining composure while troubleshooting and resolving issues., • Demonstrated ownership and commitment to continuously improving network infrastructure, constantly striving to achieve higher levels of reliability, security, and performance., • Strong experience in collaborating across both technical and business divisions to drive the successful delivery of large-scale enterprise projects., • Advanced experience designing, building, and maintaining cloud network infrastructure in public cloud environments such as AWS or GCP. Number of openings 0 Looking for a career at a company that will support you, challenge you and help you grow? IG Group can provide that. IG Group is a FTSE 100 fintech operating across five continents, serving over 1.3m customers and handling billions of dollars in transactions – built on scale, trust, and proof. We didn't pivot to innovation; it's how we've always operated. What that means for the people who work here is real: genuinely complex problems to solve, the technology and resources to tackle them properly, and the kind of scope that's rare in established businesses. The bar is high – bring a curious and forward-thinking mindset and we'll give you the platform to define what comes next. Join us at IG – the future gets built here. The Perks Your growth fuels our success! Thrive with tailored development programs, mentoring opportunities with leaders, and clear career progression. Expand your network through committees, sports and social clubs. Enjoy extra time off for volunteering and community work. Learn more about the Perks here! Join us for this exciting journey. #J-18808-Ljbffr

A Leading law firm looking to recruit dedicated and experienced Court of Protection Solicitor for highly sought permanent positon. Gemini Recruitment are currently partnering with a large and established law firm. Our client serves corporate entities and private individuals in over 25 practice areas from offices throughout London and across England and Wales. Our client’s accomplishments are acknowledged and recommended in The Legal 500 and Chambers and Partners, as a top tier firm. Our client holds the Investors in People Gold Accreditation Quality Standard Mark and is LEXCEL, Cyber Essentials Plus and ISO 27001-2013 accredited and regulated by the Solicitors Regulation Authority. Our client's Court of Protection finance team act as professional deputy, managing financial affairs for many vulnerable clients. Clients are referred by the Office of the Public Guardian to Philippa Barton as panel deputy, and by litigation teams acting for incapacitated clients who have recovered damages awards. You will be responsible for day to day management of our clients’ finances including building good relationships with clients, dealing with one off requests for payments, making applications to the court, managing building projects, managing tax and insurance issues and completing OPG reports. The team also act for clients applying to be appointed as lay deputy and deal with probate matters. The team director is ranked in Legal 500 and Chambers. Client testimonials say that the team is "knowledgeable about all things Court of Protection" and they are "empathetic, approachable and diligent." The team is fast growing and very busy. The team works closely together and prioritises providing a high level of client care and a very efficient service. The successful candidate will have a genuine interest in Court of Protection Deputyship work, demonstrate a strong understanding of mental capacity law and financial deputyship matters, and be committed to delivering exceptional client care to vulnerable clients and their families. The role will involve: • Reporting directly to the Department Director., • Managing a varied caseload of Court of Protection Property & Affairs Deputyship matters., • Conducting day-to-day case management, including preparing deputyship applications, annual reports, Court documents, legal correspondence and deputyship-related applications., • Assisting with the administration of deputyship estates, including management of client finances, investments, property matters and ongoing financial affairs., • Liaising with clients, family members, case managers, financial advisers, accountants, trustees, local authorities and other professionals., • Preparing applications to the Court of Protection relating to gifting, statutory wills, property transactions and other financial matters., • Supporting compliance with Office of the Public Guardian (OPG) requirements and reporting obligations., • Maintaining accurate file management, compliance and time recording procedures., • Assisting with the supervision and mentoring of junior team members where appropriate., • Implementing recommendations arising from file reviews and supervision.Supporting business development, networking and marketing initiatives within the department., • Delivering excellent client care while managing deadlines and maintaining high professional standards., • Qualified Solicitor with 0-3 years' PQE and a clean, valid Practising Certificate., • Experience in Court of Protection Property & Affairs Deputyship work., • Good knowledge of the Mental Capacity Act 2005, Court of Protection practice and relevant procedures., • Experience managing caseloads, preparing Court applications, reports and legal documents, and meeting deadlines., • Experience of deputyship administration, financial management, OPG reporting and related Court of Protection processes would be advantageous., • Strong client care skills with the ability to work sensitively and effectively with vulnerable clients and their families., • Excellent communication and interpersonal skills, with the ability to engage confidently with clients, professional contacts and stakeholders., • Strong analytical, organisational and problem-solving abilities, with excellent attention to detail., • Ability to work independently, use sound judgement and contribute effectively as part of a collaborative team., • Commercial awareness and an interest in business development and networking activities., • Proficient IT skills, including Microsoft Office and case/document management systems., • Mental Capacity Accreditation, experience of trust management, personal injury trusts or estate administration would be advantageous but are not essential. Onofferisanattractivesalarypackage,asupportiveteamenvironmentandrealprospectsforcareerprogressionandpromotion.TheCompanywillconsiderapplicantswishingtoworkpart-time,full-timeorwithflexibleworkingarrangements.TheCompanyalsooffershybridworking,includingopportunitiestoworkfromhome. TheCompanyiscommittedtoEqualOpportunitiesandembracesdiversityandinclusivity.Itstrivestoensurethatitsworkforcereflectsthediversityofthecommunitiesitserves. #J-18808-Ljbffr

At Elanco (NYSE: ELAN) – it all starts with animals!At Elanco, we pride ourselves on fostering a diverse and inclusive work environment. We believe that diversity is the driving force behind innovation, creativity, and overall business success. Here, you’ll be part of a company that values and champions new ways of thinking, work with dynamic individuals, and acquire new skills and experiences that will propel your career to new heights.Making animals’ lives better makes life better – join our team today!We are looking for a passionate Principal Network Engineer to help us deliver and run a suite of new technology solutions for the entire company. The Principal Network Engineer role is accountable for delivering a variety of technical products, working as part of the Network Team alongside other engineers and architects. The Principal Network Engineer will be part of the team that is responsible for the development and support of the Elanco’s Network Platform. The Team works closely with the Technical Service Owners and Operations Team to constantly raise the reliability bar for our services, providing guidance for the adoption of modern technologies and zero-trust strategy in all stages of the service development life cycle.Your Responsibilities Leading large-scale projects within the organization Setting technical direction, strategic guidance and long-term vision for engineering teams Influencing company-wide engineering practices and standards Collaborating with cross-functional teams and stakeholders at all levels Solving complex, high-impact problems with innovative solutions Drives continuous improvement and innovation within the organization Proactively research new and emerging technologies and approaches to enhance the network infrastructure posture of Elanco. Engaging in the community (internally and externally) across multiple channels, looking to share, educate and inspire. Mentor and coach senior and junior engineers. This includes helping them to develop their technical skills and grow their careers. Communicate technical information to non-technical stakeholders. This could involve writing documentation, giving presentations, or meeting with clients. Represent the team in meetings with other teams and stakeholders. This could involve discussing technical issues, providing status updates, or negotiating with other teams. Contribute to the overall technical strategy of the organization. This could involve identifying new technologies or solutions that could be adopted or helping to develop the organization's technical roadmap.* Cross-functional collaboration: Projects often involve collaboration with other teams, such as security, development, and product management. The Principal Engineer may need to bridge communication gaps and ensure everyone is aligned on project goals.What you need to Succeed (minimum qualifications) At least 10 years experience in network engineering 8+ years’ hands-on experience in routing, switching, wireless, segmentation (Cisco) Experience working in manufacturing, qualified or regulated environments Strong understanding and knowledge of SDN (Software Defined Networking) technologies (Cisco SD-WAN, VMWare NSX) Solid knowledge of Network Access Control (especially Forescout) Understanding hybrid cloud environment (Azure, GCP, VMware) Familiar with network security solutions Strong communication skills with multiple examples of being able to convey complex ideas in a manner that resulted in a definitive direction and result Strong personal & work organisational skills Experience in Wireless LAN ( Meraki, Catalyst, Outdoor Wireless)What will give you a Competitive Edge (preferred qualifications) Experience in designing and building technical solutions Familiar with scripting and automation Experience within an infrastructure environment Experience in working with vendors and MSPs Strong passion for new technologies, new ideas and creative way of thinking Agile exposure and experience* Experience in Network MonitoringAdditional Information: Travel: 0-10% Location: Hook, UK - Hybrid Work Environment* Working standard hours or shift with occasional work across time zones to support the global business may be requiredElanco is an EEO/Affirmative Action Employer and does not discriminate on the basis of age, race, color, religion, gender, sexual orientation, gender identity, gender expression, national origin, protected veteran status, disability or any other legally protected statusAs a global leader in animal health, we are dedicated to innovation and delivering products and services to prevent and treat disease in farm animals and pets. At Elanco, we are driven by our vision of Food and Companionship Enriching Life and our purpose – all to Go Beyond for Animals, Customers, Society and Our People.Elanco Animal Health Incorporated (NYSE: ELAN) is a global leader in animal health dedicated to innovating and delivering products and services to prevent and treat disease in farm animals and pets, creating value for farmers, pet owners, veterinarians, stakeholders, and society as a whole. With nearly 70 years of animal health heritage, we are committed to helping our customers improve the health of animals in their care, while also making a meaningful impact on our local and global communities. At Elanco, we are driven by our vision of Food and Companionship Enriching life and our Elanco Healthy Purpose CSR framework – all to advance the health of animals, people and the planet. Learn more at . #J-18808-Ljbffr

At Zynga, we bring people together through the power of play. As a global leader in interactive entertainment and a proud label of Take-Two Interactive, our games have been downloaded over 6 billion times—connecting players in 175+ countries through fun, strategy, and a little friendly competition. Founded in 2007 and headquartered in California, our teams span North America, Europe, and Asia, working together to craft unforgettable gaming experiences. Whether you're spinning, strategizing, matching, or competing, Zynga is where fun meets innovation—and where you can take your career to the next level. Join us and be part of the play! As the Lead Game Designer for a brand-new game team, you will initially champion the "0-to-1" development of an exciting new Merge 2 title. You will own the game's creative vision, architecting its core loop, progression systems, and meta-game from scratch. As the project matures, you will transition the team into soft launch and live operations, overseeing the day-to-day economy balance, event pipelines, and monetization features designed to drive long-term player retention. • Own and drive the game's vision, aligning it with product goals and communicating it clearly to the team and stakeholders to build shared commitment., • Lead ideation and brainstorming, and translate player motivations and behavior into user experience stories, wireframes, and optimal feature design., • Mentor and grow a team of designers, fostering a collaborative, creative environment with clear goals and strong execution standards., • Partner with product, engineering, and art to guide features from concept through implementation, reviewing and approving final designs., • Improve design tools and processes to streamline the pipeline and boost team efficiency and productivity., • Use live feedback and analytics to refine systems, maintain a balanced game economy, and champion design best practices across the studio., • Effective communicator with outstanding verbal, written, interpersonal, and presentation skills., • Highly proficient with mathematical concepts and formula creation in a game environment, • Proven history of designing systems that influence player behaviors and achieve key product performance indicators., • Expert in crafting features, systems, core game loops, economies, and meta-designs to foster and enhance positive player behaviors., • Excels in a live service game environment, adept at making adjustments based on feedback from an active community., • Solid experience in the gaming industry in a design role, contributing meaningfully to multiple released titles, • Extensive experience leading a diverse and skilled design team, • Proven track record of successfully shipping games, • Highly competitive salary, • Private medical care, • Company bonus scheme, • Relocation assistance for those moving to the UK, • Awesome onsite chef serving breakfast, lunch, and lots of treats (naughty and nice), • Life insurance and a favorable pension scheme, • Healthcare cash plan including dental and optical coverage, • Amazing tech to work with and consoles to play and relax with everywhere you look! We are proud to be an equal opportunity employer, which means we are committed to creating and celebrating diverse thoughts, cultures, and backgrounds throughout our organization. Employment with us is based on substantive ability, objective qualifications, and work ethic – not an individual’s race, creed, color, religion, sex or gender, gender identity or expression, sexual orientation, national origin or ancestry, alienage or citizenship status, physical or mental disability, pregnancy, age, genetic information, veteran status, marital status, status as a victim of domestic violence or sex offenses, reproductive health decision, or any other characteristics protected by applicable law. As an equal opportunity employer, we are committed to providing the necessary support and accommodation to qualified individuals with disabilities, health conditions, or impairments (subject to any local qualifying requirements) to ensure their full participation in the job application or interview process. Please contact us at accommodationrequest@zynga.com to request any accommodations or for support related to your application for an open position. #J-18808-Ljbffr

Nevells Road Surgery are offering an exciting opportunity to join our friendly, supportive and innovative practice. We are looking for a GP Partner to work 6-7 sessions, who shares our values and has the characteristics to fit into our team, who is prepared to share the rewards of General Practice, along with the responsibilities and challenges. Ideal start date would be December 2026 but is negotiable for the right candidate. Application closing date 22nd September 2026. • 15-minute appointments, • Continuity of care, running traditional own GP patient lists, • Low home visiting practice, supported by Acute In Hours Visiting Service (AIVHS), • Extended Hours covered by local GP Federation, • SystmOne Practice, with Ardens, AccuRx and Heidi AI scribe, • 6 weeks annual leave, 2 weeks study leave (pro-rata), • 11,000 patients, Single-site, purpose-built practice, in the centre of Letchworth, 4-minute walk from the train station., • 3 GP Partners, 5 Salaried GPs, 2 ANPs, 3 Nurses, 1 HCA. Additional ARRS roles including GP, Clinical Pharmacists, Pharmacy Technician, adult mental health nurse, first contact physiotherapist and social prescribers, • Experienced administrative team effectively led by team leaders, • Supportive Partners, with active roles within local networks (LMC representative and PCN co-clinical Director), • Open-door policy for advice and second opinions, • Daily coffee and triage support huddles, • High QOF achieving, • Deliver high-quality clinical care with a commitment to continuity of care, • Communicate well within the MDT, • Be reliable and proactive, • Perform their fair share of duty sessions (usually 2 per week) and home visits (for own patient list, unless emergency or covering leave), • Undertake admin created by their patient list, including letters and correspondence, pathology, tasks and repeat prescriptions, • To contribute to QOF and enhanced service data collection and targets Must be a fully qualified GP with GMC registration and is on the GP Performers List. We are looking for a partner, who once settled into the above role, will be able to share some of the responsibilities of running the practice. We dont have fixed ideas about what this might be it will depend upon your aptitude and interests and opportunities that arise. Partner meetings are 13:00-14:00 every Tuesday. We are team of 3 GP Partners who pride ourselves on delivering excellent patient care within a friendly and mutually supportive team, both professionally and personally. We believe in providing continuity of care and work in the traditional GP model, with each GP having their own patient list. We are delighted to hear from our Locum staff that we run a very happy place to work. Whilst we run an efficient business, achieving above average GMS earnings, we all prioritise maintaining a healthy work-life balance and are not looking sacrifice our personal lives to earn more. We are an innovative practice who embrace new technologies to improve the care we provide for our patients but also protect the workload and wellbeing of our staff. We have recently introduced an AI receptionist called EMMA to reduce call wait times. Ash works 5 sessions, Jess 6 and Fraser 6. We are team of 3 GP Partners who pride ourselves on delivering excellent patient care within a friendly and mutually supportive team, both professionally and personally. We believe in providing continuity of care and work in the traditional GP model, with each GP having their own patient list. We are delighted to hear from our Locum staff that we run a very happy place to work. Whilst we run an efficient business, achieving above average GMS earnings, we all prioritise maintaining a healthy work-life balance and are not looking sacrifice our personal lives to earn more. We are an innovative practice who embrace new technologies to improve the care we provide for our patients but also protect the workload and wellbeing of our staff. We have recently introduced an AI receptionist called EMMA to reduce call wait times. Ash works 5 sessions, Jess 6 and Fraser 6. Ash Joined in 2014, leads on dementia and mental health and has a special interest in cardiology. She is CQC lead and our LMC representative. Ash enjoys cooking, travelling, yoga and playing the piano. Jess Joined in 2021, Jess leads on the Operational side of the practice and is co-Clinical Director of our PCN (Icknield PCN). Outside of work she enjoys spending time outdoors with her young family, crafting and gardening. Fraser Joined in January 2024. Fraser has an interest in dermatology, and specifically skin cancer after spending some time working as a GP in New Zealand. He is Business and Workforce lead. In his spare time, he enjoys football, especially supporting Derby County, as well as yoga, cycling, food and wine. We are very lucky to have a fantastic nursing team. We have 2 Advanced Nurse Practitioners with a wealth of experience, Linda (our clinical nurse lead, who works 4 days per week) and Karen, who works 3 days per week. They predominantly have same-day, face-to-face appointments. Additionally, we have Elaine, our Asthma and COPD nurse. Our Treatment Room nurses include Marie, working 4 days per week, maintaining a very high standard of care for our 766 registered diabetics. We are very proud that she was awarded Doctor Magazine Practice Nurse of the year award in 2012 and has continued to be amazing ever since! Bea works 5 days providing our main treatment room services, performs learning disability checks and home visits for long term condition assessments and frailty checks. Alice works as our Healthcare Assistant and is passionate about promoting health and wellbeing. She completes multiple long-term condition reviews, including CHD, AF, stroke plus MMSEs, ECGs and dressings. We have additional support for our COPD patients with remote clinics run by 2 specialist respiratory nurses. Our Business Manager, Chamila Perera joined us in January 2023, bringing a wealth of experience with 20 years managing in General Practice. Our Operations Manager, Andrew Poole joined in August 2022 and has modernised the way we work, bringing new innovative ideas. We have a fantastic team comprising 3 medical secretaries and 12 part-time administrative staff (including team-leaders, care navigators, coders and a care-coordinator). The usual front line pressure withstanding, the team is cohesive and effective. We embrace a very open and supportive atmosphere. We host social occasions through the year, with an annual Christmas party funded by the Partners. Our patients have access to Out of Hours through 12 Point Care, at the nearby Sollershot GP surgery. There is also an Urgent Care Centre at Lister Hospital, Stevenage, which includes Mental Health Urgent Care. The Hertfordshire Acute In Hours Visiting service see our patients for any acute issues, which hugely reduced the number of home visits performed by our GPs, usually to 0 or 1 per week. This is generally to provide care to Palliative patients or routine matters for housebound patients on our own lists. • GMC registered GP This post is subject to the Rehabilitation of Offenders Act (Exceptions Order) 1975 and as such it will be necessary for a submission for Disclosure to be made to the Disclosure and Barring Service (formerly known as CRB) to check for any previous criminal convictions. Applicants must have current UK professional registration. For further information please see NHS Careers website (opens in a new window). #J-18808-Ljbffr

Location: London Bridge Sector: Tax, Corporate Tax, Personal Tax, OMB Tax Contract Type: Permanent Salary: £70,000 - £90,000 + Commission Contact: David Elliot Contact email: david@clark-wood.co.uk Contact phone: +44 (0) 1173 291051 London Bridge | £70,000 - £90,000 + Commission | Hybrid | Progression to Head of Tax & Partner | Clark Wood is working with a modern, ambitious and rapidly growing London accountancy practice looking for a Tax Senior Manager to build and ultimately lead its Tax department. This is much more than a standard Senior Manager position. You'll work directly with the firm's founders, have significant autonomy over the tax offering and a defined progression route to Head of Tax, Salaried Partner and ultimately Equity Partner. The firm specialises in SMEs and owner-managed businesses, with growing advisory work across tax planning, restructuring, R&D, HMRC enquiries, business disposals and employee/investment incentive schemes. • Advise SME owners across Corporate, Personal and Partnership Tax, • Lead complex tax planning, restructuring, succession and exit projects, • Advise on EMI, EIS, SEIS and ERS, • Manage and respond to HMRC enquiries, • Support the wider accounts team on complex tax matters, • Build relationships with existing clients and external referrers, • Generate and develop new Tax Advisory work, • Recruit and lead the tax team as the department grows, • Work directly with the founders on the strategy and direction of the Tax practice, • CTA qualified with strong post-qualified experience, • Strong technical knowledge across SME / OMB taxation, • Confident advising business owners directly, • Experience across both compliance and advisory work, • Commercially minded with an interest in business development, • Able to explain complex tax matters clearly to clients, • Ambitious to ultimately lead and grow a Tax department, • Experience across every technical area isn’t required ProgressionThis position has a clearly defined route: Tax Senior Manager - Head of Tax - Salaried Partner - Equity Partner The intention is for the successful candidate to progress to Head of Tax within approximately 2-3 years, subject to the growth of the department, with a route to Equity Partner within approximately 3-4 years. • £70,000 - £90,000 basic salary, • 15% commission on first-year fees from newly generated Tax work, • 7.5% commission on first-year fees from new work generated from existing clients, • Annual salary reviews, • Discretionary firm-wide profit share, • Hybrid working - minimum 3 days in the office / with clients, • 25 days’ holiday + bank holidays, • Private medical insurance, • Pension, • Professional subscriptions covered, • Training and CPD costs covered, • Genuine route to Equity Partnership #J-18808-Ljbffr

Job Ref: AS/77248/GM Package: £Negotiable + Bonus + Benefits Location: UK Wide - Remote Job Type: US/UK Tax Manager Position Type: Permanent Hours: Full-time Contact Name: Andy Shaw Contact Company: JAM Global Mobility Recruitment The Background: This leading consultancy is actively seeking and experienced US/UK Tax Manager to strengthen their UK team. The Role: The US/UK Tax Manager will be responsible for but not limited to the following: Manage & lead a team of US/UK Tax Consultants Advising high net worth individuals on their US/UK tax issues. Support and advise clients in the areas of tax compliance, tax accounting and tax transformation. Work in conjunction with other internal departments and teams. Communicate directly with customers and tax authorities. The Person: The successful candidate will have previous experience of dealing with both US & UK individual tax and the associated issues. Applicants will be educated to degree level (or equivalent); any additional tax qualifications would be desirable but are not essential. To Apply: Please forward your CV or call Andy Shaw on +44 (0)754 569 7713 or via FaceTime, Skype, WhatsApp or Messenger. In compliance with the new regulations (April 2004) in place under the Employment Agencies Act, JAM Global Mobility will require proof of identification. JBRP1_UKTJ

CLS helps clients navigate the changing FX marketplace – reducing risk and creating efficiencies. Our extensive network and deep market intelligence enable CLS specialists to lead the development of standardized solutions to real market problems. Our innovative, forward-looking products make the trading process faster, easier, safer and more cost-effective – empowering our clients’ success. Functional title Infrastructure IT Architect Location London Corporate title Conract Report to Department Technology & Operations No. of direct reports 0 The CLS Architecture practice establishes and maintains the architectural framework to support the technology strategy within which IT solutions can be delivered. It is responsible for ensuring CLS continues to deliver reliable, resilient, cost-beneficial business service solutions (current, planned and speculated) through the formulation of the enterprise strategy and architecture framework for the CLS IT Systems, underpinned by the technical governance and compliance of IT Systems designs. To act as an Infrastructure Architect on a variety of internal and external IT delivery projects, key responsibilities include: • Produce high quality High Level Design documentation describing technical systems solutions, providing overall design direction and recommendations for resolution of complex technical issues, • Provide technical leadership and direction to the IT engineering, delivery and test teams throughout implementation phases, • Act as a liaison between Architecture and Engineering and direct the development of technical standards and platforms, quality and best practices., • Support the Enterprise Architects in the development of infrastructure road maps to support the evolution of the technical and digital portfolios from current to future state. This role will be aligned primarily against the Settlements business line which designs and delivers key mission critical systems for the organization and its customers. Integration and collaboration with non-settlements teams may also be required to drive and deliver standards and technology efficiencies. Key knowledge, skills and experience required for the role: • Solid understanding and design capability across multiple infrastructure domains such as networks, compute, storage, database, backups, virtualization, private cloud, data center, collaboration & end user, • In-depth technical knowledge across several infrastructure disciplines, e.g. Microsoft Technologies, Red Hat/Linux, VMWare, ESX, vSphere, Citrix, IBM Websphere MQ, Oracle, DB2, LAN/WAN/MAN, Routing, Firewall, Wireless, IDS/IPS, WAN optimization, Proxy, VPN services, Load Balancing and IT Security, • Experience or technical knowledge of toolsets and infrastructure management solutions, • Experience designing, documenting, integrating and managing complex infrastructure solutions Additionally the successful candidate will demonstrate the following personal characteristics: • Proactive self-starter able to learn quickly and work/deliver independently, • Be able to multi task as several projects and initiatives may be active at the same time, • Possess strong interpersonal and influencing skills, • Excellent analytical and communication skills, • Leadership, presentation and stakeholder management skills, • Ability to work on complex projects with globally distributed teams and tight timelines, • Ability to design high availability solutions, including consideration to fault tolerant analysis and resiliency, • Ability to work with and manage vendors/suppliers such as IBM, • Experience of producing designs within governance frameworks, • Experience of infrastructure transformation programmes, • Bachelor and/or Master’s Degree in Business, Finance, Computer Science or related field, or equivalent experience, • Relevant IT Architecture certification (TOGAF, CITA, RHCA etc.) or technical accreditations (VMWare, Cisco or Juniper) beneficial. #J-18808-Ljbffr

AI Editorial is operating at an inflection point, acting as a strategic partner to product managers and technology teams to deliver critical projects across the business. This role embeds dedicated product management expertise into the function, working to identify, shape and drive opportunities for editorial subject matter expertise to power customer-facing AI innovation. The role also holds strategic oversight of cross-functional reporting and establishes ROI metrics for how editorial expertise is deployed and valued across the business. This is a product leadership role. Experience in content and publishing is strongly preferred, tax or legal experience a plus., • Acts as strategic product partner to product managers and technology teams across the business, identifying, shaping and driving opportunities for editorial subject matter expertise to power customer-facing AI innovation, • Establishes and owns cross-functional reporting frameworks and ROI / utilisation metrics that demonstrate the value and impact of editorial subject matter expertise within AI product development, • Translates data, customer feedback and audience insight into clear product decisions, trade-offs and prioritisation calls, • Builds scalable processes and ways of working for editorial-to-product handoff, embedding product discipline (roadmaps, backlogs, sprint rhythms) into editorial's contribution to AI development, • Coaches and upskills editorial subject matter experts in product thinking and ways of working, without formal management responsibility for the wider team Delivers regular, clear reporting and progress updates to senior leadership, flagging risks early with practical mitigation options, bringing external product and platform best practice into a professional services / legal-tech environment Bachelor's degree, preferably in computer science, business, accounting, finance, law, or related field • 8+ years' product management experience, ideally including digital media, news publishing, content platforms, or other complex multi-stakeholder digital ecosystems, • Experience managing strategic platform or technology partnerships and complex external relationships, • Strong grounding in fundamental AI/ML product concepts, with the ability to get up to speed quickly on domain-specific applications, • Fluent in product analytics and using data to define and track success metrics, including ROI and utilisation measures, • Working knowledge of agile/product delivery frameworks and tooling (roadmapping, backlog management, sprint planning), • Demonstrated success leading cross-functional teams (engineering, editorial/content, commercial) to deliver results in fast-moving, matrixed environments Experience building products or capabilities from the ground up, including in ambiguous or 0-to-1 contexts, Hybrid Work Model: We've adopted a flexible hybrid working environment (2-3 days a week in the office depending on the role) for our office-based roles while delivering a seamless experience that is digitally and physically connected. Thomson Reuters informs the way forward by bringing together the trusted content and technology that people and organizations need to make the right decisions. We serve professionals across legal, tax, accounting, compliance, government, and media. Our products combine highly specialized software and insights to empower professionals with the data, intelligence, and solutions needed to make informed decisions, and to help institutions in their pursuit of justice, truth, and transparency. Reuters, part of Thomson Reuters, is a world leading provider of trusted journalism and news. We are powered by the talents of 26,000 employees across more than 70 countries, where everyone has a chance to contribute and grow professionally in flexible work environments. At a time when objectivity, accuracy, fairness, and transparency are under attack, we consider it our duty to pursue them. Sound exciting? Join us and help shape the industries that move society forward. As a global business, we rely on the unique backgrounds, perspectives, and experiences of all employees to deliver on our business goals. To ensure we can do that, we seek talented, qualified employees in all our operations around the world regardless of race, color, sex/gender, including pregnancy, gender identity and expression, national origin, religion, sexual orientation, disability, age, marital status, citizen status, veteran status, or any other protected classification under applicable law. Thomson Reuters is proud to be an Equal Employment Opportunity Employer providing a drug-free workplace. We also make reasonable accommodations for qualified individuals with disabilities and for sincerely held religious beliefs in accordance with applicable law. More information on requesting an accommodation here. • Flexibility & Work-Life Balance: Flex My Way is a set of supportive workplace policies designed to help manage personal and professional responsibilities, whether caring for family, giving back to the community, or finding time to refresh and reset. This builds upon our flexible work arrangements, including work from anywhere for up to 8 weeks per year, empowering employees to achieve a better work-life balance., • Career Development and Growth: By fostering a culture of continuous learning and skill development, we prepare our talent to tackle tomorrow's challenges and deliver real-world solutions. Our Grow My Way programming and skills-first approach ensures you have the tools and knowledge to grow, lead, and thrive in an AI-enabled future., • Industry Competitive Benefits: We offer comprehensive benefit plans to include flexible vacation, two company-wide Mental Health Days off, access to the Headspace app, retirement savings, tuition reimbursement, employee incentive programs, and resources for mental, physical, and financial wellbeing., • Culture: Globally recognized, award-winning reputation for inclusion and belonging, flexibility, work-life balance, and more. We live by our values: Obsess over our Customers, Compete to Win, Challenge (Y)our Thinking, Act Fast / Learn Fast, and Stronger Together., • Social Impact: Make an impact in your community with our Social Impact Institute. We offer employees two paid volunteer days off annually and opportunities to get involved with pro-bono consulting projects and Environmental, Social, and Governance (ESG) initiatives., • Making a Real-World Impact: We are one of the few companies globally that helps its customers pursue justice, truth, and transparency. Together, with the professionals and institutions we serve, we help uphold the rule of law, turn the wheels of commerce, catch bad actors, report the facts, and provide trusted, unbiased information to people all over the world. #J-18808-Ljbffr

CLS helps clients navigate the changing FX marketplace – reducing risk and creating efficiencies. Our extensive network and deep market intelligence enable CLS specialists to lead the development of standardized solutions to real market problems. Our innovative, forward-looking products make the trading process faster, easier, safer and more cost-effective – empowering our clients’ success Functional title Location London Corporate title Level 2 Report to Department Technology & Operations No. of direct reports 0 The CLS Enterprise Data Architect will be responsible for the design and maintenance of the enterprise data architecture. The individual will interact with the business stakeholders to ensure alignment with the corporate strategy. • Provide advanced technical support in design and use of information systems technology including architecture and database management, • Provide technical and data leadership to the application development group, including being able to advise on the future direction of systems, • Technically evaluate existing data architecture / design of information technology systems and providing alternative solutions and recommend appropriate path for a product / project., • Responsible for designing and implementing data solutions, developing and implementing data strategies, providing technical guidance and oversight during all phases of the software development life-cycle, • Provide innovative approaches to business outcomes in order to create new solutions that achieve competitive advantage., • Through example and behavior, provide peer leadership to other team members with the goal of being excellent service providers and enablers to other constituencies (both internal and external), • Actively mentor other team members both technically and professionally, • A minimum of 8 years of IT experience of which 3+ years should be in a senior data architect role, • Posesses an up-to-date knowledge of latest technologies (including cloud-native technologies), technology trends, and third party solutions for data management problems., • Financial and/or Banking industry experience preferred, • Bachelor and/or Master’s Degree in Business, Finance, Computer Science or related field, • Relevant IT Architecture certification (e.g. TOGAF) is beneficial, • Possess strong interpersonal and influencing skills with good stakeholder engagement, • Excellent analytical and communication skills, • Leadership, stakeholder management and line management skills, • Ability to visualize, articulate and solve complex technical problems, • Ability to work on complex projects with globally distributed teams and tight timelines #J-18808-Ljbffr

Main area General Practitioner Grade Locum Rates Contract Ad-hoc: 0 years Hours Flexible working - 0 hours per week Job ref 4265-8301865 Site Watford UTC Town Watford Salary £75.04 - £123.36 per hour Salary period Hourly Closing 03/10/2026 23:59 HUC is excited to be supporting the delivery of Watford Urgent Treatment Centre (UTC) from 1 September 2026 through the provision of GP staffing. HUC delivers NHS 111 and Out of Hours (OOH) GP services to more than 4.5 million patients across Hertfordshire, Cambridgeshire, Bedfordshire, West Essex, and the South West of England. We are proud to support the NHS by providing safe, responsive and patient-centred urgent care services. We are seeking independent, self-employed General Practitioners to provide face-to-face GP services on a sessional basis within our Urgent Treatment Centre and Out of Hours services. Whether you are looking to accept sessions on a regular or ad hoc basis to complement your existing commitments, we would be pleased to hear from you. Once we receive your expression of interest, you'll be invited to complete our compliance process by uploading the required documentation via our Credentially platform. Following successful compliance clearance, you will be provided with access to RotaMaster, where you can view available sessions and choose those you wish to accept. This is a self-employed sessional engagement. There is no obligation on HUC to offer sessions, and no obligation on you to accept any sessions offered. Each session is agreed separately and remunerated at the agreed sessional rate. If you're looking for a flexible opportunity to provide urgent GP services while maintaining control over when you work, we'd be delighted to hear from you. • Uphold the principles of the General Medical Council's "Good Medical Practice" by representing HUC and the NHS professionally, ensuring consistency and the sharing of best practices across clinical services., • Make independent, professional decisions to address individual patient issues effectively., • Evaluate and address the healthcare needs of patients presenting with undiagnosed or undefined conditions., • Maintain accurate, clear, and timely consultation records in line with agreed professional standards., • Prescribe treatments appropriately, adhering to the HUC prescribing formulary., • Manage case lists proactively to minimize reliance on face-to-face services, including ambulance referrals, A&E visits, urgent care centres, and out-of-hours services., • Ensure all cases are handled promptly, providing patient support or reallocating cases if delays occur., • Collaborate closely with operational managers on duty to deliver seamless services and achieve clinical and quality outcome., • Adhere to safeguarding protocols and uphold best practices in clinical governance. What we offer: • Competitive sessional rates., • Flexible self-employed sessional opportunities., • The ability to view available sessions and choose those you wish to accept., • Opportunities to provide services alongside an experienced multidisciplinary clinical team., • A rewarding opportunity to support patients requiring urgent care within their local community., • Fully qualified GP with GMC registration and included in the GP Register., • 2 years post-CCT experience., • Annual appraisal and revalidation., • General practice (Vocational Training Scheme) with MRCGP examination or equivalent., • On the relevant medical performers list (with no conditions preventing working or restrictions on practice)., • Full professional indemnity., • Membership of relevant Specialist Societies or Associations., • Be a practising GP, • Fully qualified GP with GMC registration, • Practising as a GP Please note that we are unable to offer visa sponsorship for this role. Applicants must have the right to work in the UK for the full duration of their employment without requiring employer sponsorship, including after the expiry of any time-limited visa (such as a Graduate visa). We reserve the right to close this vacancy early, should we receive sufficient applications. You must have appropriate UK professional registration. This post is subject to the Rehabilitation of Offenders Act 1974 (Exceptions) Order 1975 (Amendment) (England and Wales) Order 2020 and it will be necessary for a submission for Disclosure to be made to the Disclosure and Barring Service. #J-18808-Ljbffr

Blackstone is the world’s largest alternative asset manager. Blackstone seeks to deliver compelling returns for institutional and individual investors by strengthening the companies in which the firm invests. Blackstone’s over $1.3 trillion in assets under management include global investment strategies focused on real estate, private equity, credit, infrastructure, life sciences, growth equity, secondaries and hedge funds. Further information is available at www.blackstone.com. Follow @blackstone on LinkedIn, X (Twitter), and Instagram. About the Role As a Product Manager (AVP) on the AI Platform team, you will own core enterprise AI platform capabilities that make the platform secure, scalable, and extensible. You'll focus on the governance, administration, security, and enablement features that internal teams require to build and run AI agents and workloads at scale — spanning our LLM Gateway, MCP Gateway, agent runtime, and model governance controls. This role requires strong technical judgment, a deep understanding of enterprise deployment patterns, and the ability to translate complex platform requirements into elegant, self-service product experiences for builders across the firm. • Own the roadmap for core platform capabilities including the LLM and tool (MCP) gateways, web search access, audit logging, access controls, and integration of approved AWS and Azure AI services., • Develop and maintain the builder experience end to end — onboarding new agent and workload builders, managing existing workloads, and enforcing platform policies., • Build features that give leadership and security teams visibility into and control over AI platform usage, including cost attribution, chargeback, and usage governance., • Partner with engineering to deliver scalable, secure architecture that meets Blackstone's enterprise and regulatory requirements., • Define APIs and integration points that enable agent workflows, tool access, and system connectivity across Copilot, AWS Bedrock, and embedded applications., • Work closely with Platform Engineering, SRE, Security, and Data teams to understand cross-platform pain points and translate them into prioritized product requirements., • Build relationships with product managers across business-unit-facing technology teams to understand their needs and validate solutions., • Stay current on the competitive landscape and enterprise AI market trends, and bring an informed point of view on build-versus-buy decisions., • 4+ years of product management experience, with at least 2 years focused on enterprise or platform software., • Track record of shipping enterprise platform features that drive adoption in security-conscious, regulated organizations., • Strong understanding of enterprise platform concepts such as authentication/authorization, access controls, auditability, and multi-tenant governance., • Experience taking a product from 0 to 1, from problem definition through launch and iteration., • Excellent communication skills, with the ability to work across technical and business stakeholders and influence without authority., • Experience with cloud computing, infrastructure, and AI/ML products or platforms (e.g., AWS, Azure, model gateways, agent frameworks)., • Technical background or a history of working closely with platform and infrastructure engineering teams., • Structured thinking and the ability to break down complex technical requirements into shippable, well-scoped platform features. The duties and responsibilities described here are not exhaustive and additional assignments, duties, or responsibilities may be required of this position. Assignments, duties, and responsibilities may be changed at any time, with or without notice, by Blackstone in its sole discretion. Blackstone is committed to providing equal employment opportunities to all employees and applicants for employment without regard to race, color, creed, religion, sex, pregnancy, national origin, ancestry, citizenship status, age, marital or partnership status, sexual orientation, gender identity or expression, disability, genetic predisposition, veteran or military status, status as a victim of domestic violence, a sex offense or stalking, or any other class or status in accordance with applicable federal, state and local laws. This policy applies to all terms and conditions of employment, including but not limited to hiring, placement, promotion, termination, transfer, leave of absence, compensation, and training. All Blackstone employees, including but not limited to recruiting personnel and hiring managers, are required to abide by this policy. If you need a reasonable accommodation to complete your application, please contact Human Resources at 212-583-5000 (US), +44 (0)20 7451 4000 (EMEA) or +852 3656 8600 (APAC). Depending on the position, you may be required to obtain certain securities licenses if you are in a client facing role and/or if you are engaged in the following: Attending client meetings where you are discussing Blackstone products and/or and client questions; Marketing Blackstone funds to new or existing clients; Supervising or training securities licensed employees; Structuring or creating Blackstone funds/products; and Advising on marketing plans prepared by a sales team or developing and/or contributing information for marketing materials. Note: The above list is not the exhaustive list of activities requiring securities licenses and there may be roles that require review on a case-by-case basis. Please speak with your Blackstone Recruiting contact with any questions. At Blackstone, we look to attract and retain the brightest minds in the business, hiring professionals across a wide range of disciplines. Our employees are integral to the firm’s identity, contributing to a culture of integrity, professionalism and excellence. It is their dedication and passion for their work that has helped Blackstone become a trusted partner for some of the largest institutional investors in the world. We encourage independent thinking and reward initiative, while providing services to help employees grow professionally. Our global business platform and brand reputation provide an unparalleled launch pad for growing your career. #J-18808-Ljbffr

End Date Tuesday 29 September 2026 Salary Range £0 - £0 We support flexible working – Flexible Working Options Hybrid Working, Job Share Job Description Summary . Job Description We’re looking for an Associate Director to join the Cash Management and Payments Structuring team, a part of Transactional Structuring team within Transaction Banking Solutions (TBS). The team’s remit spans Cash Structuring & Execution & Digital Assets Strategy. They’re responsible for solutioning & executing transactions whilst actively supporting origination, product and commercialisation teams managing TBS CIB clients. Providing specialist expertise across liquidity, payments, collections, account structures and treasury transformation initiatives, while ensuring successful delivery through an end-to-end transaction execution framework. The team supports the development of the bank's digital assets strategy within Transaction Banking, identifying future opportunities relating to tokenised money, digital payments, settlement innovation and emerging cash management models! Working closely with Sales, Product, Coverage, Implementation, Operations, Technology, Legal, Risk and Compliance, the Associate Director acts as a solution architect and execution lead for strategically important and complex client opportunities. • Leading the design and solutioning of complex cash management, liquidity and treasury solutions, • Integrating cash, payments, receivables, payables, working capital and FX considerations into holistic client solutions, • Assessing legal, regulatory, tax, operational and execution risks associated with proposed structures, helping to identify and mitigate commercial risks, • Leading the end-to-end execution of complex Transaction Banking mandates from deal inception through implementation and stabilisation, • Providing oversight and guidance to Associates in the preparation of solution papers and contribution to Sales team presentations, ensuring accurate analysis, clear articulation of risks and mitigants, and high-quality committee‑ready submissions, • Collaboration with Product and Technology teams to transition strategic concepts into executable client solutions, • Actively feedback observations around competitor approaches and capabilities to the product teams. Understand the external market and competitor capabilities, enabling LBG to consider gaps in proposition with the potential to unlock growth, • Supporting the delivery of P& L targets of Transaction Banking business. This includes identifying cross‑sell opportunities, • Supporting the development of the Transaction Banking digital assets strategy including business cases and commercialisation strategies for emerging capabilities, • Building relationships with internal stakeholders across Sales, Coverage, Product, Risk Operations, Client Services, and delivery, acting as a trusted partner, • Supporting the development and mentoring of junior colleagues, • Ensuring compliance with group policy and regulatory requirements, • Proven experience in solutioning complex cash management and treasury offerings and ability for deal execution, collaborating effectively with internal and external partners, • Significant experience within Transaction Banking, Treasury Services, Cash Management or Liquidity Solutions including Channels e.g. Banking Platforms, APIs, SWIFT, Cash products, Cheque products, Card products, • The ability to communicate expertlly with clarity, credibility and influence in technical internal and external discussions, • Strong commercial foresight and client advisory capability, • Excellent stakeholder management and influencing skills, • Strong presentation, communication and problem‑solving abilities, • Experience of digital assets, tokenised money, stablecoins, CBDCs or emerging settlement technologies, • Deep understanding of corporate treasury operating models for large corporates and institutional clients, • Professional qualifications in treasury, finance or project management We’re on an exciting journey and there couldn’t be a better time to join us. The investments we’re making in our people, data, and technology are leading to innovative projects, fresh possibilities, and countless new ways for our people to work, learn, and thrive. Our ambition is to be the leading UK business for diversity, equity and inclusion supporting our customers, colleagues, and communities and we’re committed to creating an environment in which everyone can thrive, learn and develop. We were one of the first major organisations to set goals on diversity in senior roles, create a menopause health package, and a dedicated Working with Cancer Initiative. We offer reasonable workplace adjustments for colleagues with disabilities, including flexibility in office attendance, location and working patterns. As a Disability Confident Leader, we guarantee interviews for a fair and proportionate number of applicants who meet the minimum criteria for the role with a disability, long‑term health or neurodivergent condition through the Disability Confident Scheme. We provide reasonable adjustments throughout the recruitment process to reduce or remove barriers. Just let us know what you need. We also offer a wide ranging benefits package, which includes: • A generous pension contribution of up to 15%, • An annual performance‑related bonus, • Share schemes including free shares, • Benefits you can adapt to your lifestyle, such as discounted shopping, • 30 days’ holiday, with bank holidays on top, • A range of wellbeing initiatives and generous parental leave policies At Lloyds Banking Group, we're driven by a clear purpose; to help Britain prosper. Across the Group, our colleagues are focused on making a difference to customers, businesses and communities. With us you'll have a key role to play in shaping the financial services of the future, whilst the scale and reach of our Group means you'll have many opportunities to learn, grow and develop. We keep your data safe. So, we'll only ever ask you to do confidential or sensitive information once you have formally been invited. We also provide reasonable adjustments to reduce or remove barriers. Should you wish to contact us for any reason, please email us at: careers@lloydsbanking.com For more Flexible Working Options please use the free text search, e.g. job sharing, variable hours, to identify relevant matches. #J-18808-Ljbffr

Immigration Solicitor / Lawyer / Attorney - Client Following Required Job Type: Permanent Salary: £Negotiable Location: UK (remote) Start Date: ASAP Contact Name: Andy Shaw Contact Company: JAM Recruitment This highly respected law firm is seeking a confident and commercially minded immigration professional with a legal qualification, strong technical expertise, excellent interpersonal skills and a client following. The successful candidate will advise a portfolio of corporate clients on the full range of UK immigration matters, providing clear, practical and solution-focused guidance. The Role: The Immigration Solicitor will be responsible for but not limited to the following: Take proactive ownership of a portfolio of clients, overseeing the end-to-end immigration process and ensuring a consistently high level of service. Ensure full compliance with UK immigration legislation, regulations and procedural requirements. Manage cases in a structured, proactive and highly accurate manner, maintaining strong attention to detail throughout. Monitor and manage key performance indicators (KPIs) and service level agreements (SLAs), ensuring agreed service standards are consistently achieved. Act as the primary point of contact and trusted advisor for clients, providing clear, commercially focused immigration guidance. Identify and implement opportunities to improve processes, efficiencies and the overall client experience. Take responsibility for engagement budgets, financial performance and profitability. Lead and oversee complex and high-profile/VIP immigration cases. Communicate confidently and effectively with clients, colleagues and external stakeholders at all levels. Support and contribute to RFPs, tenders and other business development initiatives. Represent the organisation at client seminars, webinars and other industry events, acting as a subject matter expert. Identify and pursue business development opportunities, supporting the growth of existing client relationships and developing new business. Help develop, mentor and lead a high-performing team of immigration specialists and associates. Drive robust risk-management and compliance checks for both new and existing clients. The Person: UK-qualified lawyer with extensive knowledge of UK immigration law. Strong, up-to-date knowledge of UK immigration legislation and practice. Knowledge or experience of international legal systems and EU legislation would be advantageous. Demonstrable experience managing large-scale, complex client programmes and portfolios. Excellent written and verbal communication skills, with strong interpersonal and stakeholder-management capabilities. Highly analytical, commercially aware and detail-oriented, with the ability to assess priorities and manage competing demands effectively. Strong business judgement, strategic thinking, professional integrity and work ethic. Proven ability to manage multiple priorities and work effectively in a fast-paced environment. Willingness and flexibility to travel when required. Strong client-service mindset with a focus on building long-term trusted relationships. Takes full ownership and accountability for decisions, actions and outcomes. Highly organised, proactive and able to handle sensitive and confidential information appropriately. APPLY NOW: Please forward your CV or call Andy Shaw on +44 (0)754 569 7713 including: FaceTime, Skype, WhatsApp or Messenger. JAM Immigration Recruitment is acting as an Employment Agency in relation to this vacancy. Should this position not meet what you are looking for, please forward to someone you feel may be interested in this position. View our latest jobs today on our website and follow us on Facebook, X & LinkedIn JBRP1_UKTJ

0 The Senior Project Manager ensures that the projects within their remit deliver the agreed business benefits on time, to budget, to the required quality standard, all within the CLS Project Governance framework. They will be: • Responsible for the delivery of the Kyndryl / IBM Infrastructure Change portfolio of projects as assigned by the Head of Technology Change & Transformation, • Responsible for defining and delivering Kyndryl / IBM Infrastructure roadmap in partnership with the Head of Infrastructure., • Responsible for developing, in conjunction with the Project Sponsor, a definition of the project(s) and ensures the project is effectively resourced and manages the relationships with a wide range of groups (including all project contributors)., • Responsible for managing the work of consultants, securing and utilising internal resources in an efficient manner and maintaining a co-operative, motivated and successful team., • Defines plans through a rigorous and highly interactive process of defining business requirements, project specifications, managing resources and environments., • Agrees and formalizes plans, conducts or co-ordinates required business analysis where necessary. Presents plans and business cases and gains their sign off from sponsors and other stakeholders., • Relationship/Vendor management; develop and maintain strong relationships with stakeholders, both internal and external., • Create project business case for all projects and ensure the benefits are measurable and agreed by all stakeholders. Responsible for demonstrating that stated benefits have been realised once the project has been delivered., • Manage day-to-day operational aspects of a portfolio of projects, scope and budget, • Manage and maintain interlock of projects with other project managers, • Effectively apply, support and champion the CLS Governance methodology and enforce project standards, • Review deliverables prepared by the project teams before company-wide review, • Identify and lead the virtual project team, • Where required, recruiting project staff and consultants, • Managing co-ordination of the partners and working groups engaged in project work, • Ensure project documents are complete, current, and stored appropriately, • Detailed portfolio planning and control including:, • Developing and maintaining a detailed project roadmap., • Managing project deliverables in line with the project roadmap., • Act as an escalation point for project risk and issues., • Resolving cross-functional issues at project level where necessary., • Strong oversight of project scope and change control., • Monitoring project progress and performance from a benefit realisation, time, cost and quality perspective., • Providing status reports in line with CLS’ internal standards and regulatory requirements., • Financial management across the portfolio of projects. Partnering with the finance department and ePMO, • Liaison with, and updates progress to, project steering board/senior management, • From time to time, provide cover for peers and assist in the creation and issuance of departmental reports, • Understand basic revenue models, P/L, and cost-to-completion projections, apply analysis to this data to make project decisions and provide reporting of this data (Earned Value Reporting), • Coach and mentor junior members of staff, • Display complete ownership for projects leading by example, • Capable of managing a project team effectively through matrix management. Need to be able to get the best out of a team of people who may not be direct reports., • Experienced at managing stakeholders ensuring strong communication and governance is in place., • Influence and manage the project managers and project teams (internal and external) to deliver to the required constraints of time, budget and quality., • A “self starter” who does not wait to be asked, prepared and thorough in all aspects of the role. Competencies required for successful job performance • Significant practical experience of leading and managing Infrastructure change programs across an end-to-end project lifecycle, • Strong history of managing third party service providers to deliver a range of change activities, • Extensive hands‑on experience of delivering complex IT change projects in a high performance organisation, • Have had responsibility of delivering book of work with budget in excess of £5m, • Extensive knowledge of delivering with vendor organisations and suppliers, • Excellent communication skills with practical experience of supporting technical teams to formulate and articulate business benefits through the construction of business cases, • Demonstrable experience of quantifying the effort required to deliver a solution whilst articulating any implications of any proposed solution on the wider business and existing systems, • Experience delivering a wide range of Infrastructure projects – Networks, Storage, AIX, Microsoft, • Proficient in creating well‑structured and good quality project documentation with excellent skills in the use of the MS Office suite of tools and MS Project, • Experience of using Microsoft Project to produce and maintain high quality project plans, • Strong personal work ethic with a “can‑do” attitude, • Motivated delivery focused individual, • Proven ability managing projects in a complex & demanding environment. Experience, education and any certifications as necessary for successful job performance • 10+ years of project management experience, • 5+ year of program/portfolio management experience Personal characteristics contributing to an individual's ability to excel in the position • Proactive Leader – Strong management skills which make you effective at leading a project team, negotiating with Senior Managers, stakeholders and external suppliers and contractors. You should be able to positively influence all stakeholders to ensure a cost effective quality deliverable whilst ensuring effective time management to get the job done., • Strong communicator – Be able to demonstrate a number of years of experience of communicating clearly at all levels within a business and with senior sponsors and internal and external stakeholders. Be well experienced in both the “Art” as well as the “Science” of project management to ensure that CLS obtains the maximum value for its investment., • Delivery of Business Benefits – A comprehensive understanding and demonstrable experience in ensuring that all projects deliver quantified business benefits., • Excellent Problem solving skills – Demonstrable competencies in solving problems. Always challenging ‘facts’ in order to find the best plan to deliver the project. Where and when necessary, eliminate early and appropriately to management prior to avoid issues and deviations to plan., • Consultative relationship management – Gets to the heart of the issues with a presence and gravitas and clarity of presentation across all forms of communication., • Strong People Management Skills – Able to bring the best out of people and a team through leading by example and by coaching and mentoring staff members and developing personalised self-development plans., • Delivery focused – Understands that delivery is the overarching principle for the role of a portfolio manager and maintains focus on delivery across the wider reaching portfolio. #J-18808-Ljbffr

End Date Tuesday 29 September 2026 Salary Range £0 - £0 We support flexible working – click here for more information on flexible working options Flexible Working Options Job Share Job Description Summary . Job Description JOB TITLE: Lead Customer Journey Manager LOCATION: Jersey or Isle of Man HOURS: Full-time WORKING PATTERN: Our work style is hybrid, which involves spending at least two days per week, or 40% of our time, at our office site. What you’ll be doing: An exciting opportunity has arisen within the Crown Dependencies Lab within the Markets Platform, part of the Non Ring-fenced Bank, to lead our Fids, Funds and Corporate Feature Team. You'll help us maintain our current platform as well as manage its evolution to support growing customer demand for digital services and products within our estate. You’ll need to develop a deep understanding of industry trends, and a willingness to apply your technical knowledge to making customer’s experiences better. Within our Lab, we challenge ourselves daily to create an extraordinary team environment, in which people bring out the best in themselves by providing autonomy and ensuring they feel and a safe space to experiment. The Lead Customer Journey Manager plays a critical role in product development, working with Product Owners and the wider product team to understand, measure and orchestrate customer journeys. The role combines strong customer journey expertise with technical capability, enabling effective translation of customer, business and regulatory needs into technology-enabled solutions. By understanding processes, systems, data flows and integration points, the Lead Customer Journey Manager helps shape prioritisation decisions and ensures design choices deliver the intended customer and business outcomes. The role is responsible for understanding and optimising the end-to-end customer experience, both internal and external, ensuring customer needs remain at the forefront of all journeys. They lead the continuous improvement of journeys by finding opportunities to simplify processes, remove inefficiencies and enhance customer outcomes through effective use of data and technology. Working closely with Product, Experience Design, Engineering and Operations teams, the Lead Customer Journey Manager ensures customer journeys, process designs and technical solutions are aligned and accurately represented. The role acts as a bridge between business and technology teams, orchestrating delivery across functional boundaries to ensure journeys are scalable, efficient, compliant and effective. • To be eligible for this role, you'll need to have right to live and work in the Isle of Man (this is different to UK right to work Lead the delivery and continuous improvement of customer journeys, processes and technology solutions, using established change, business analysis and knowledge management frameworks. Conduct research and analysis across customer, operational, process, system and data sources to identify trends, root causes, risks and opportunities, supporting evidence-based decision making. Identify inefficiencies, gaps and control weaknesses across customer journeys, processes and systems, driving improvements that enhance customer outcomes and business performance. Partner with business, technology, engineering, design and operations teams to understand system capabilities, data flows and dependencies, ensuring solutions are scalable, achievable and aligned to customer needs. Develop and maintain customer journey maps, process maps and supporting documentation, ensuring operational, data, technology and regulatory considerations are accurately represented. Evaluate the feasibility, value and impact of new products, services, processes and technology-enabled solutions, providing recommendations and supporting implementation. Manage journey-level risks, dependencies and stakeholder alignment across people, process, technology and data, ensuring effective delivery of customer and business outcomes. Monitor customer journey performance using feedback, operational metrics and data insights, finding opportunities to optimise experiences, efficiency and service effectiveness. Act as the subject matter expert for assigned journeys, contributing to long-term planning, future operating models and technology-enabled propositions while balancing customer, operational, regulatory and technical requirements. If you think all banks are the same, you’re wrong. We’re a pioneering, fast-changing business that’s shaping finance as a force for good. If you’re after a role where you can have an impact and do the best work of your career, you’ve just found it. In this role, you’ll act as the senior customer advocate within delivery, ensuring customer needs are effectively translated into prioritised, scalable and value-driving solutions that are delivered. You’ll be responsible for shaping and improving end-to-end customer and colleague journeys, ensuring customer outcomes remain at the heart of change delivery; you’ll need to have 2+ years' experience and broader experience in change, business analysis or product delivery, providing leadership across the CJM/business analyst community, driving quality standards, and influencing strategic decisions across business and technology teams. • Customer journey mapping and process analysis., • Requirements gathering and documentation., • Stakeholder engagement and collaboration., • Understanding of business processes, systems and data., • Identification of customer problems and improvement opportunities., • Supporting testing, implementation and change activities., • Strong communication, problem-solving and analytical skills. This is a place for you: Our ambition is to be the leading UK business for diversity, equity and inclusion supporting our customers, colleagues and communities, and we’re committed to creating an environment in which everyone can thrive, learn and develop. We were one of the first major organisations to set goals on diversity in senior roles, create a menopause health package, and a dedicated Working with Cancer Initiative. We offer reasonable workplace adjustments for colleagues with disabilities, including flexibility in office attendance, location and working patterns. And, as a Disability Confident Leader, we guarantee interviews for a fair and proportionate number of applicants who meet the minimum criteria for the role with a disability, long-term health or neurodivergent condition through the Disability Confident Scheme. We provide reasonable adjustments throughout the recruitment process to reduce or remove barriers. Just let us know what you need. • A generous pension contribution of up to 15%, • An annual performance-related bonus, • Benefits you can adapt to your lifestyle, such as discounted shopping, • 30 days’ holiday, with bank holidays on top, • A range of wellbeing initiatives and generous parental leave policies Ready to make an impact? At Lloyds Banking Group, we're driven by a clear purpose; to help Britain prosper. Across the Group, our colleagues are focused on making a difference to customers, businesses and communities. With us you'll have a key role to play in shaping the financial services of the future, whilst the scale and reach of our Group means you'll have many opportunities to learn, grow and develop. We keep your data safe. So, we'll only ever ask you to provide confidential or sensitive information once you have formally been invited along to an interview or accepted a verbal offer to join us which is when we run our background checks. We'll always explain what we need and why, with any request coming from a trusted Lloyds Banking Group person. We're focused on creating a values-led culture and are committed to building a workforce which reflects the diversity of the customers and communities we serve. Together we’re building a truly inclusive workplace where all of our colleagues have the opportunity to make a real difference. #J-18808-Ljbffr

Job Ref: AS/76720/GM Package: £Negotiable + Bonus + Benefits Location: London, UK Job Type: US Corporate Tax Senior Consultant Position Type: Permanent Hours: Full-time Contact Name: Andy Shaw Contact Company: JAM Global Mobility Recruitment The Background: This leading boutique consultancy is actively seeking and experienced US Corporate Tax Senior Consultant to strengthen their team in London. The Role: The US Corporate Tax Senior Consultant will be responsible for but not limited to the following: Advising national and international companies on US corporate tax issues. Take into account any national and international US tax law. Support and advise clients in the areas of tax compliance, tax accounting and tax transformation. Work in conjunction with other internal departments and teams. Communicate directly with customers and tax authorities. The Person: The successful candidate will have previous experience of dealing with US corporate tax and the associated issues. Applicants will be educated to degree level (or equivalent); any additional tax qualifications would be desirable but are not essential. To Apply: Please forward your CV or call Andy Shaw on +44 (0)754 569 7713 or via FaceTime, Skype, WhatsApp or Messenger. In compliance with the new regulations (April 2004) in place under the Employment Agencies Act, JAM Global Mobility will require proof of identification. JBRP1_UKTJ

RAN Engineer Location: West Midlands Contract: Initial 4 - 6 months Rate: £400£500per day, depending on experience Matthew James Group are supporting a client with a major private 5G deployment within a large manufacturing environment and are looking for an experienced RAN Deployment & Integration Engineer with a strong Ericsson background. This is a hands-on deployment and commissioning role supporting the installation, integration, testing and stabilisation of an Ericsson Private 5G indoor RAN / Radio Dot System. RAN Engineer You will support deployment and commissioning activities across the private 5G network, including: Installation and verification of Ericsson BBUs and IRUs Inspection and validation of existing Ericsson Radio Dots Verification of grounding, power, cabling and GNSS synchronisation Day-0 / Day-1 commissioning activities Network Controller to RAN integration IRU and Radio Dot registration Radio configuration and operational-status validation SIM onboarding and provisioning support Throughput and latency testing Mobility and handover testing Redundancy and failover testing ATP / acceptance testing and defect closure Troubleshooting BBU, IRU, Radio Dot and radio integration issues RAN Engineer You should have: 5+ years' Ericsson RAN experience Strong Ericsson BBU commissioning experience Experience deploying or integrating IRUs and/or Ericsson Radio Dots Good knowledge of LTE and 5G RAN Experience supporting ATP / acceptance testing Strong fault-finding and integration experience In return the RAN Engineer will get the chance to work for an amazing company offering an initial 4-6 month contract with the possibility of further extension. TPBN1_UKTJ