Driving jobs in Philadelphia, PA - Page 18Create job alerts

Job Description Commercial Lead HVAC Installer We're searching for an experienced and dynamic Commercial Lead HVAC Installer to spearhead the installation of complex commercial HVAC systems. If you excel at leading crews, possess advanced knowledge of hydronics and heavy equipment, and are committed to unwavering excellence and safety, this is your opportunity to drive success. Enjoy fantastic benefits, competitive pay, and a local position where your leadership makes a tangible impact! What's in it for you? * Excellent Compensation: Earn a competitive hourly rate of $30 - $55 per hour, plus a yearly bonus that rewards your contributions. * Robust Benefits Package: Enjoy a comprehensive suite including company-paid life insurance, short-term disability & long-term disability. * Strong 401(k) Match: Benefit from a dollar-for-dollar match on 401(k) contributions up to 3% (increasing to 5% starting January 1st); eligibility begins 90 days after your start date. * Comprehensive Health Coverage: Receive 80% of health, vision, and dental premiums paid for all levels, plus an HRA card for out-of-pocket medical expenses; eligibility starts on the 1st of the month after your start date. * Celebrating Our Team: Participate in an annual holiday party and our special HVAC Tech Day celebration! Key Responsibilities As a Commercial Lead HVAC Installer, you will be the driving force behind successful commercial HVAC installations, ensuring projects are completed with precision and efficiency. Your daily responsibilities include: * Maintaining consistently high standards of excellence for all projects, from start to finish. * Strictly following company and job site safety procedures to ensure a secure working environment. * Leading a crew of HVAC Installers and Apprentices through various tasks to complete diverse installation projects. * Reviewing and maintaining job schedules through the appropriate use of manpower, material, equipment, and time. * Coordinating seamlessly with other trades as necessary to ensure project flow. * Properly documenting time and material applied to projects for accurate job costing purposes. What We're Looking For * Exhibit outstanding leadership and problem-solving skills, with proven experience supervising members of a project team. * Proficiently read blueprints, diagrams, and schematic drawings to accurately determine work procedures. * Possess advanced knowledge of hydronics and extensive experience in the installation of hydronic systems. * Must have experience installing key commercial equipment including boilers, chillers, and cooling towers. * Skillfully work with different types of pipe, including PVC, Victaulic, black pipe, and copper pipe. * Ability to safely operate hoisting and lifting devices such as material lifts and jacks to accurately position machinery and parts during system installations. * Demonstrate strong written and verbal communication skills and a proactive "Can Do" attitude. * Ability to lift up to 75 lbs. Ready to lead complex HVAC installation projects and elevate your career? If you're an experienced Commercial HVAC Installer with strong leadership, hydronics expertise, and a commitment to precision, apply today to become a vital part of the team!

Job DescriptionSr. Credit Risk Review Analyst - Commercial LendingBlue Bell, PA Join our highly skilled Credit Risk Review (CRR) team as a Senior Credit Risk Review Analyst specializing in Commercial Lending. CRR's primary objective is to provide timely and independent assessments of credit exposures and credit risk, with results reported directly to senior management and the Risk Committee of the Board of Directors. In this hybrid role (3 days in-office, 2 days remote), you'll provide independent, expert assessments of Commercial credit exposures. You may also take on the responsibility of Reviewer in Charge, leading review engagements, managing reviewers, conducting portfolio analysis, and summarizing findings from credit file samples. Your deep understanding of commercial lending and credit risk practices will be crucial in providing valuable insights and recommendations to enhance our credit risk management. Responsibilities • Execute Complex Reviews: Independently assess complex credit and credit-related transactions, including facility structures and underwriting processes, leveraging your expert knowledge of credit policies and procedures. Understand inherent risk and the materiality of risk for credit transactions., • Validate and Ensure Accuracy: Validate scorecard risk ratings and borrower credit administration. Ensure a thorough understanding of portfolio issues, trends, and root causes to effectively manage credit portfolios., • Independent Reporting & Communication: Independently complete work papers, track issues, compile supporting documentation, and follow up on exam findings with business leaders. Act as a Second Level Reviewer and effectively communicate credit risk review objectives, outcomes, and recommendations for issue remediation., • Risk Analysis & Monitoring: Analyze risk in assigned credit portfolios by reviewing relevant reports and assessing trends. Provide expert analytical insights, identify risk concentrations, systemic trends, or issues, and participate in continuous monitoring for assigned portfolios., • Leadership & Expertise: Oversee file review activities of other reviewers as the Reviewer in Charge for assigned business segment(s). Perform assessments of file review results and findings to determine final ratings and draft review reports. Serve as an expert resource to the team., • Extensive Credit Expertise: Robust credit knowledge and strong experience in Commercial credit extension and management., • Experience with Complex Transactions: 10+ years of Credit Risk or Credit Underwriting experience, specifically with larger, more complex transactions in Commercial, CRE, Corporate Banking, Leveraged Lending, Middle Market, etc., • Communication Skills: Strong verbal and written communication skills, with the ability to navigate and handle difficult conversations effectively with stakeholders., • Banking Experience: Experience at larger banks (asset size $80B+)., • Deal Size Exposure: Experience with average deal sizes of $50MM., • Underwriting Background: Experience in underwriting for ABL, Business Banking, Corporate Banking/Mid-Market, or Lower Mid-Market commercial segments. Benefits • $125,000 to $175,000+ Full benefits package Bonus + Paid Relocation Assistance

Job Description Project Manager – Substation FindTalent is seeking a highly motivated Project Manager – Substation on behalf of our client, a leading engineering firm specializing in Transmission & Distribution (T&D) projects. This role offers a dynamic opportunity to directly manage substation projects across the Northeast Region, lead multidisciplinary teams, and contribute to the ongoing growth and success of the T&D business. Position Overview: The Project Manager – Substation will be responsible for overseeing multiple substation engineering projects, ensuring safety, quality, and profitability. This role involves close collaboration with internal teams and clients, driving projects from concept through completion while maintaining client satisfaction and adhering to company standards. The ideal candidate will have a strong background in substation design, project management, and leadership. Key Responsibilities: * Lead planning, budgeting, and execution of substation projects. * Ensure overall project success, focusing on safety, quality, and profitability. * Manage projects from initial concept through permitting, design, procurement, and construction. * Collaborate with cross-functional teams to meet client expectations and project goals. * Develop and maintain client relationships, serving as the primary point of contact. * Prepare proposals, lead client presentations, and negotiate contracts. * Identify project risks and develop mitigation strategies. * Monitor project financials, staffing, and scheduling to ensure on-time, on-budget delivery. * Implement project controls, policies, and procedures. * Provide regular updates on project progress, risks, and key issues. Additional Responsibilities: * Serve as a key contact for major clients within the region. * Conduct quality reviews of substation design projects as needed. * Mentor junior staff and support their professional development. * Collaborate with other project managers and support recruitment and retention efforts. * Contribute to long-term business planning and the growth of the substation group. Qualifications: * Bachelor’s degree in Engineering from an accredited institution. * Minimum of 7 years of experience in substation design and engineering project management. * Professional Engineering (PE) license required. * Strong project management skills, including financial oversight, scheduling, and risk management. * Excellent communication, leadership, and client relationship management skills. * Ability to travel up to 50% as required. * Valid driver’s license. Preferred Qualifications: * 10+ years of substation design and project management experience. * Project Management Professional (PMP) certification or advanced degree in Engineering/Construction Management. Why Join This Opportunity? * Lead critical substation projects that impact regional energy infrastructure. * Work with a company known for its commitment to safety, client satisfaction, and engineering excellence. * Be part of a growing T&D team with opportunities for leadership and advancement. * Competitive salary and comprehensive benefits package. Apply now through FindTalent to advance your career in substation project management. FindTalent is an equal opportunity recruiter. We celebrate diversity and are committed to creating an inclusive environment for all candidates.

Job Description$500 Signing Bonus! We are a family-owned Early Intervention Agency that provides SLP, OT, and Special Instruction throughout the County of Philadelphia We are hiring a licensed special education teacher with experience in early intervention to work with a caseload of 10 children minimum, between the ages of 3 and 5 in homes and early learning centers throughout Philadelphia. We are looking for contracted staff only. *It is a requirement that you MUST hold a Pennsylvania certification in Early Childhood or Special Education. Responsibilities: • Provide direct therapy, • Communicate with parents and caregivers,, • Collaborate with classroom teachers in regard to interventions, • Communicate with service coordinators and other members of the transdisciplinary team, • Write individualized IEP goals., • Document sessions and manage caseloads with a user-friendly software systemRequirements:, • An individual must have a PDE instructional certificate in Grades Pre-Kindergarten-4, Special Education PK-8 OR an individual must have a Bachelor’s or Master’s Degree from an accredited college or university in early intervention, early childhood special education, early childhood education, child development, special education or elementary education and working towards one of these certificates., • Flexible Schedules, • Performance bonusesAbout Us:VCFS was founded in 2000 by Joetta Moran Kersey, a speech-language pathologist, who worked for the School District of Philadelphia. Joetta saw a need for education and support for families with small children. Her desire to address this gap became the driving force for our vision: to empower parents and caretakers and strengthen their connections to resources, increasing their child’s ability to learn, grow and thrive throughout the cycles of life.

Job Description Job Purpose Summary: Responsibilities Include: Monitor and direct the daily schedule of clients; including performing tasks and staying on schedule to attend all treatment and activities. Organization and punctuality are key. • Transport clients to treatment facility, and back to residence in Victory Bay transport vehicle. Comply with driving guidelines and GPS monitoring system., • Monitor the condition and behavior of all clients for intoxication/drug use., • Administer Urine Analysis and breathalyzer on scheduled days of the week and communicate to medical the results via email., • Promptly relieving previous Peer Recovery Specialist and completing shift change report., • Conduct searches of clients at intake and assist in completing intake paperwork., • Always maintain and control company keys., • Monitor clients and direct into group sessions or appointments when needed., • Make concerted effort to build relationships with each client, and model healthy communication as part of program of Recovery., • Complete transportation notes in KIPU daily., • Complete client notes in KIPU weekly., • Manage and defuse conflict between clients impartially and respectfully. Effectively remind clients of rules and consequences of breach. Enforce punitive measures when necessary., • Maintain a collegial but professional demeanor, reflective of healthy sobriety, and appropriate boundaries with each client., • Adhering to scheduled client transports and arrive to the facility in a timely manner., • Report to and communicate with Direct Supervisor., • Valid Driver's License - Reviewed by MVR report, • Current CPR Certification, • Narcan training, • Peer Recovery Specialist Certification, • Crisis Prevention Institute Certification (Within first 90 days of employment)

Job Description Job description Growing company looking for an experienced fire alarm inspector/repair technician (NICET CERTIFIED IS A PLUS) responsible for servicing, inspecting and testing fire alarm systems. Performing on-site emergency troubleshooting; programming and repairs of our customer's fire alarm systems; identifying code issues; and preparing accurate and timely service tickets and reports. Duties may also include assisting in the installation of fire alarm systems. Overtime is available! • Company provided iPad. Job Types: Full-time, Contract Benefits: • 401(k), • Dental insurance, • Health insurance, • Paid time off, • 8 hour shift

Job Description CARING PEOPLE ALLIANCE JOB DESCRIPTION Case AideCUA Cares Center Employment Status: Full-time FLSA Status: Non-Exempt Reports to: CUA Case Management Supervisor Grade: Location: CUA Cares Center Schedule: Statement of General Purpose The Case Aide supports the achievement of objectives established in the Single Case Plan. The Case Aide will conduct and participate in home, school, and community visits, and assist in accessing resources and records. This position will require direct client interaction and execution of transports, assessments and supportive interventions in order to support delivery of child welfare services. In addition, the Case Aide will assist in maintaining documents and other administrative functions related to client records. Examples of Essential Functions and Responsibilities • Provides transport of the family to visits, school, medical appointments, court, conferences and other essential appointments. This includes proper installation and use of car seats., • Obtains, maintains, and files documents/records., • Completes necessary purchases and deliveries for families, including groceries, food, and other urgent necessities., • Supervises visits when necessary with the knowledge of what appropriate supervision is available to intervene if children and youth are at risk., • Reports relevant details about interactions to supervisor and team., • Provides in-home and community support to families in order to increase their well-being and functioning., • Provides advisement on the organization and maintenance of the home, various life-skills, and availability of community resources., • Participates in Family Team Conferences and internal meetings when necessary., • Completes all paperwork and other documentation in a timely manner in accordance with the OHS CUA Practice Guidelines., • Other duties as assigned. Core Competencies • Experience working directly with people from diverse racial, ethnic, and socioeconomic backgrounds., • Demonstrates and supports a culture of diversity, equity and inclusion. Passionate about working in an organization that values and promotes diversity, equity, inclusion and anti-racism., • Skilled to handle any driving situation on the road with the ability to control the vehicle in every situation; knowledge of all regulations of the road., • Ability to provide accurate and timely reports and recommendations., • Knowledge of community resources., • Strong oral and written communications skills., • Strong working knowledge of computer applications (Microsoft Office, Excel) and ability to work with various digital information systems., • Ability to establish and maintain positive, professional relationships with clients, coworkers and visitors., • Ability to work a flexible schedule to meet the needs of children, youth, and families and to cover emergencies., • Ability to work independently, demonstrating good judgment and prioritizing skills., • Ability to maintain a high degree of discretion dealing with confidential information. Minimum Requirements • High School Diploma or equivalent and, • Two (2) years or more experience working in environment involving children, youth and families with knowledge of child, youth and family service systems and community resources is preferred. Work experience in social service, education, health care or related field is a plus and case management, • Driver’s license with clean driving record. ADA Component • This role requires regular hearing, talking, walking, and sitting; occasional standing, driving, and lifting up to 25 pounds. This is not intended to be an exhaustive list of all responsibilities and duties. Employees may be directed to perform job-related tasks other than those specifically described in this description. The job description does not constitute an employment agreement between the employer and employee and is subject to change by the employer as the needs of the employer and requirements of the job change. Caring People Alliance is an equal opportunity employer.

Job Description You are a P.E. with 15+ years of hands-on structural engineering experience, seeking an intellectually stimulating new challenge. You have a broad understanding of design and construction. You are already an expert. Robson Forensic will train you to be a forensic expert. As a Structural Engineering Forensic Expert, you will: • Investigate structural engineering incidents., • Analyze structural engineering procedures, applying your comprehensive knowledge of standards and practices., • Write clear, scientifically sound reports., • Provide expert testimony. You will delve into the "why" behind incidents, critically assessing decision-making, operational procedures, and the standard of care. This role offers you a chance to: • Use your cumulative training, experience, and critical thinking skills., • Collaborate with highly respected experts., • Continuously learn and grow., • Make a tangible difference. Location: Columbus/Dublin, OH & Lancaster, PA Requirements: • You have a Bachelor’s degree in Engineering., • You have a P.E. license and your S.E license is a plus., • You have 15+ years of hands-on structural engineering experience., • You have broad structural and vertical construction experience (horizontal also is a plus)., • You have construction management, maintenance, and structural design experience in residential, industrial, institutional, or commercial structures., • You can work both independently and as part of a collaborative team., • You have excellent technical, analytical, writing, and communication skills., • You are willing to travel about 20% on average., • You have a valid driver’s license with a clean driving record and the ability to drive., • Prior forensic experience is not required. We seek professionals eager to apply their deep industry knowledge to a challenging new area. About Us: Robson Forensic is a national leader in expert witness consulting, providing technical expertise across many fields within engineering, architecture, science, and a broad range of specialty disciplines. Employees at Robson Forensic work alongside highly respected experts from both industry and academia. Our forensic experts are engaged in meaningful casework that is consequential to industry and society. Robson Forensic provides a unique working dynamic that blends collaboration and autonomy. We are an Equal Opportunity Employer. How to Apply: If this opportunity meets your requirements for a challenging and rewarding career and you meet our minimum requirements, please apply and attach your resume and a cover letter outlining your professional background and experience.

Job Description Kreyco (formerly known as LLN) is a nationwide organization that specializes in PK-12 education. We support language learners of all kinds by connecting schools nationwide to teachers for languages and other content areas. Our schools and students are our driving force, and as we seek to meet their needs, we are searching for language teachers of all sorts. Currently, we have an onsite middle school, science teaching opportunity available for the 2025-2026 school year. Compensation varies and depends on your teaching project, ranging from $400 to $1,200 weekly. Daytime teaching availability is required. No night or weekend classes! Kreyco ensures that all of our teachers have everything they need to be successful in their classrooms. This includes providing a comprehensive curriculum to our teachers, connecting them to supervisors and mentors in our network, and offering numerous professional development opportunities completely free of charge. Kreyco always has our teachers' backs! Our team is constantly growing as more and more schools reach out, hoping to offer language instruction to their students. As our network of schools expands nationwide, so does our network of teachers. We are always seeking qualified teachers to join our team. Kreyco teachers are qualified, passionate, and dedicated educators. Our teachers may come from diverse backgrounds, with work experience in a wide range of careers, but all share a common goal: they believe in the positive impact that learning a second language can have on our students. If this belief resonates with you, Kreyco may be your new professional home. Job Summary: • Job Location: On-site, • Schedule: M-F, daytime teaching hours, • Employment Type: Independent contractor You can learn more about Kreyco and what it is like to work with us by following this link to watch a short video: We look forward to hearing from you soon! Requirements • Bachelor's degree, • Reside in the US, • Authorized to work in the United States, • Ability to commute, • Professional development

Job DescriptionBenefits: • Competitive salary, • Flexible schedule, • Competitive wages, • PMT Certification Program - Training, Skills Development coupled with pay increases, • Guaranteed Hours Company Overview EverLine Coatings and Services is a premier line painting and maintenance company that proudly has a location servicing the Southern Jersey & Greater Wilmington region. We provide high-quality line painting and pavement maintenance services for parking lots, and warehouses. In addition to painting services, we offer power sweeping, power washing, asphalt seal coating, crack filling, and more. Our success is a direct result of our dedicated team. Every employee at EverLine is committed to providing complete customer satisfaction in the delivery of our services. We work hard, have fun, and have an amazing corporate culture. Our teams are DRIVEN: Dedicated Resourceful Integrity-Focused Value-Based Excelling Nourishing Are you ready to make an impact? Job Summary Our Pavement Maintenance Technicians utilize our specialized equipment and apply materials on pavement surfaces in order to provide maximum value for our clients' pavement assets. Responsibilities WHAT YOULL DO • Use equipment to perform line painting, asphalt crack filling and seal coating, power washing, interior safety markings and more, • Plan and facilitate the production of a high-quality project, • Communicate job status daily with the Operations Manager, • Maintain a safe, hazard-free job site, • A New Jersey drivers license with a clean driving record (Drivers Abstract is required) and a reliable mode of transportation, • You are a self-motivated, critical thinker that likes to problem solve, • You understand the importance of punctuality, organization, and attention to detail, • Ability to work in a physically demanding role with lots of walking, bending, and lifting (up to 75lbs), • Ability to work well independently unsupervised, • Past experience with small engines (like lawnmowers) and/or paint sprayers is an asset, • An Engineering educational background is an asset

Job DescriptionBenefits: • Dental insurance, • Health insurance, • Opportunity for advancement We are a family-owned Early Intervention Agency that provides SLP, OT, PT, and Special Instruction throughout the County of Philadelphia. We are hiring a licensed speech-language pathologist with experience in early intervention to work. You will be working with a minimum of 20 children ages ages birth through 5 at preschools and early learning centers in Philadelphia or our office close to St. Joe's University. We are not accepting Clinical Fellows at this time but encourage early career professionals to check back for future opportunities Responsibilities: • Provide direct therapy, • Communicate with parents and caregivers,, • Collaborate with classroom teachers in regard to interventions, • Communicate with service coordinators and other members of the transdisciplinary team, • Write individualized goals for the IFSP/IEP, • Document sessions and manage caseloads with a user-friendly software systemRequirements:, • Masters Degree from ASHA accredited university, • Current Certificate of Clinical Competence (CCC) in Speech-Language Pathology, • Active state-level licensure as a Speech-Language Pathologist (SLP)Perks/Benefits:, • Flexible Schedules, • Performance bonuses, • PTO, • Health Benefits

Job DescriptionDescription: SUMMARY The Account Manager will be responsible for managing relationships with our facilities, ensuring exceptional service delivery, and driving business growth. You will serve as the primary point of contact for our clients, collaborating closely with healthcare providers to optimize medication management and enhance patient care. This is a field role which will require daily local travel and occasional overnight travel. Dependable personal transportation is necessary. ESSENTIAL FUNCTIONS: To perform this job successfully, an individual must be able to perform each essential function satisfactorily. The requirements listed below are representative of the knowledge, skill, and/or ability required. Predictable, reliable, and punctual attendance is an essential function of the job role. The functions are as follows but not limited to: • Develop and maintain strong relationships with key decision-makers at the facilities, working with facility leadership and floor staff to be the liaison between facility and pharmacy., • Serve as the main point of contact for assigned accounts, understanding their needs and working with facility and pharmacy to provide quality care to the customer, • Provide support and guidance to facilities inf regards to medication therapy and compliance, in collaboration with directors of clinical services and pharmacy operations, • Address client inquiries, concerns, and issues promptly and effectively, • Identify opportunities for expanding services and introducing new products to meet client needs, • Conduct training sessions and educational programs for facility staff on startups, and as requested by the customers. Training on facility and pharmacy systems will be required, • Provide monthly onsite visits and reporting to the facility as part of ongoing customer success and improvement, • Ensure compliance with all relevant laws, regulations, and industry standards, • Collaborate with internal pharmacy teams to ensure seamless coordination of services for clients, • Survey preparation for facilities The physical demands and work environment described here are representative of those an employee encounters while performing the essential functions of this job. Sitting for extended periods of time, computer usage including data entry for much of the workday, regular phone communication, handling paperwork and documentation, and participating in meetings. Field position requiring frequent local travel throughout the state and occasional overnight stays. Travel: 90% of time on the road, On call. MINIMUM REQUIREMENTS: Education & Experience: LPN or RN, with 1 or more years of experience, preferably in the Long Term Care or healthcare industry; or an equivalent mix of education and experience. Ability to handle escalated issues with diplomacy and professionalism a must. Long term care pharmacy experience preferred. Computer Skills: Intermediate computer proficiency. Pharmacy and medication distribution software (EMAR, Medbank, Frameworks preferred). Language Skills: Ability to read and interpret documents such as medication documentation, business correspondence and procedure manuals; ability to write routine reports and business correspondence; ability to speak effectively, both in person and by telephone, to customers or employees of the organization. Mathematical Skills: Ability to add, subtract, multiply, and divide in all units of measure, using whole numbers, common fractions, and decimals; ability to compute rate, ratio, and percent and to draw and interpret bar graphs; ability to understand and interpret statistical reports, data charts and graphs. Requirements:

Job Description Access Services is hiring Behavioral Health Support team members to join our Starting Point Mobile Psychiatric Rehabilitation program in Montgomery County. Learn about what the job is like from the voices of our Starting Point team in this three-minute video: Starting Point: We Do Mental Health Differently, and our program webpage: Starting Point - Access Services. The Starting Point program offers support to individuals in the unique model of Psych Rehab, serving those with a mental health diagnosis, to reach their own, personally identified goals. Sometimes people need extra help to get back on their feet, find a place to live, and become a part of community life. Our behavior health support team meets with individuals in their own spaces to help them begin their recovery journey. As a behavior health support staff, you will empower adults with mental illness to pursue their goals using the Psych Rehab model. You will meet weekly with those served to help identify a person's strengths, needs, and barriers in accomplishing the identified goal. Goals can include anything from finding and maintaining employment, getting involved in community activities, establishing healthy habits, finding housing, and so much more. Once established, the behavior health support team will support individuals to gain skills and resources to reach their goals. You can expect professional career development through weekly coaching and individual supervision, and level up your mental health skills with group trainings. Anyone who joins the team is offered the opportunity to grow personally and have genuine impact on people's lives. Staff who are passionate about empowering people to find strength within themselves to reach their own goals, while using clinical and case management skills will thrive with Starting Point. Work Schedule: Monday- Friday 9am-5pm or 8am-4pm (With flexibility on evenings required based on the needs of individuals served) Key Responsibilities: • Build rapport and effectively engage with individuals about their life goals and barriers to recovery., • Drive to and meet with individuals in homes and community locations., • Collaborate with the individual being served and the Starting Point team to develop, implement, update and review treatment plans that are recovery-oriented, strengths-based, and person-centered., • Collaborate with individual being served to develop successful strategies for identifying, achieving, and maintaining goals in four key areas: living, learning, working, and socializing., • Maintain accurate and current case documentation in an electronic health record., • Bachelor’s degree or Certified Peer Specialist (CPS) preferably in a related field such as psychology, social work, human services (required), • Some prior work or internship experience related to mental health services (preferred), • Valid driver’s license with 2+ years of driving experience, reliable vehicle, and car insurance (required), • Willingness to drive throughout the county during the workday to meet with clients (required - mileage reimbursement provided) Pay: Starting at $20.00 per hour, with rates negotiated by education and related work experience. Our full-time comprehensive benefits package includes: • Health, Vision, Rx, & Dental insurances, HSA/FSA, 401k program., • Tuition Reimbursement., • 20 Days PTO (vacation, sick days), 7 paid holidays, 2 floating holidays., • Mileage/Toll Reimbursement, paid travel time between worksites., • Life Insurance, Short/Long Term Disability, Catastrophic Sick Leave, Paid Parental Leave., • Employee Assistance Program (telehealth/in person)., • Referral Bonuses up to $750 per hire.

Job Description Automotive Sales Consultant - adding to staff There are often many New & Used Car Dealers looking for Salespeople, it's crazy! Most dealerships have turnover/change & do not follow through on the promised Pay Plans plus could disappoint their staff, so. . . they need to constantly hire. Guess what, our New Car Dealership in Morris County is different. We have an opening because one of our most respected/loved Sales Associate who started in 1983 retired & we want to continue our growth seeking the right person to replace them. If you’re ready for a change - to work in a super comfortable work environment, a genuinely easy schedule with some of the very BEST people in the business, please reach out right away. In a world that often seems to not value people, teamwork & honesty anymore, know that we sure do! If you have prior Auto Sales experience, that's awesome & we'll offer you tools plus support to make you even better! We have a Pay Plan based entirely on volume, not Gross Profit. Really! It's simple with no surprises & will allow a talented Salesperson to easily make $100,000 and more. And the best part - we won't change your Pay Plan when you start to make the big income you've earned. Key word - earned. If you've never sold cars before, that's okay for the right person who's looking for a career, plus willing to learn. We have a home & an opportunity to earn the income you've always wanted, but couldn't get. If you're confident, focused, love working with/connecting with people & have crazy energy, this is where you need to be. We are happy to work with you, train you & watch you grow, plus prosper! If you've had disappointing/bad experiences with other job opportunities, please hit your reset button.....do come to talk with us! Job Responsibilities · Come in early/on time, be super happy, motivated & be dedicated to making more money that you ever have. · Understand/connect with, plus show our valued customers what makes you with our dealership & brand special. · You will be guaranteed a minimum of $1,000/wk. even during training! Really. · You will be asked to work a 5-day work week with only 3 nights until 8:00p - we close at 6:00p on Friday's & Saturday's so those nights are always yours. Closed on all Sundays!!! · We offer the best full company benefits including Health/Dental/Eye Care & Life Insurance for you/your family if needed, Profit Sharing & 401K. · Must have a clean driving record & live close, so you can spend more time with your family & here with us - than driving in the car. We're only 10 minutes from Morristown!

Job DescriptionDescription: Xiente is seeking a Youth Mentor/Driver to join our team. The ideal candidate will be responsible for providing mentorship and transportation services to youth in our program. The Youth Mentor/Driver will be responsible for ensuring the safety and well-being of the youth while transporting them to and from various activities. Requirements: • Provide mentorship and guidance to youth in our program, • Transport youth to and from various activities, including school, appointments, and extracurricular activities, • Ensure the safety and well-being of the youth while in transit, • Maintain a clean and safe vehicle for transportation, • Communicate effectively with parents, guardians, and program staff, • Attend training and meetings as required Requirements: • High school diploma or equivalent, • Valid driver's license and clean driving record, • Experience working with youth in a mentorship or counseling capacity, • Ability to communicate effectively with youth, parents, and program staff, • Strong organizational and time management skills Requirements • High School Diploma, • Ability to drive a van with students, • Availability from 6:00 pm to 11:00 pm and 9pm-2am, • Experience working with teenagers and middle schoolers.

Job DescriptionDescriptionWe are seeking an experienced and passionate Multi-Site Veterinarian to join our team as a Regional Medical Director! This is a full-time, salaried position offering a unique opportunity to lead and mentor veterinary teams across our network of hospitals in the dynamic Northeast and Southeast regions. If you're a driven leader with a commitment to exceptional patient care and a desire to shape the future of veterinary medicine, we encourage you to apply! About the Role: As Regional Medical Director, you will play a crucial role in overseeing a portfolio of 40-50 animal hospitals, acting as a key partner and resource for our dedicated veterinary teams. This exciting role involves weekly travel throughout the East Coast, allowing you to work with diverse practice teams and build strong relationships with our hospital staff. You will be instrumental in driving excellent patient care by collaborating with veterinary teams on a variety of initiatives, including: • Elevating Patient Care: Monitoring doctor interactions and medicine protocols to ensure the highest standards of care., • Developing Our Teams: Mentoring and coaching staff, fostering a positive and collaborative work environment., • Resolving Challenges: Assisting in the resolution of staff and/or client conflicts, promoting effective communication and problem-solving., • Driving Operational Excellence: Collaborating with the leadership team (Regional Directors, Practice Managers, Veterinarians, etc.) to support staff and optimize business operations., • Ensuring Compliance: Maintaining operational and medical execution consistent with company policies and procedures, including tracking package utilization, responding to client and staff concerns, monitoring discounts, and ensuring compliance., • Growth & Performance: Taking ownership of preserving transaction rates and pet count, contributing to the overall success of the region., • Mentorship & Support: Providing guidance and support to new graduate veterinarians, helping them thrive in their careers.Ideal Candidate: The ideal candidate is a highly motivated and experienced veterinarian with a proven track record of leadership and a passion for animal welfare. Strong communication, interpersonal, and organizational skills are essential, as is the ability to adapt to a fast-paced, multi-site environment. Location & Travel: This is a field-based role requiring weekly travel throughout the Southwest. To facilitate efficient travel logistics, candidates must reside within close proximity to a major airport in one of the following major metropolitan areas: Charlotte, Raleigh, Atlanta, Washington DC, Greenville, Philadelphia, New York City, Boston, Chicago, Tampa, Orlando, or Miami. Key Responsibilities • Practice alongside our DVMs, help with cases and provide mentorship., • Practice alongside our DVMs, help with cases and provide mentorship., • Review cases when requested by Regional Director (RD), DVM, or Practice Manager (PM)., • Monitor flow of hospitals, appointments, and client satisfaction., • Support area hospitals by filling urgent needed shifts., • Provide support and review for negative case outcomes., • Monitor Vetshare App for content and engagement., • Analyze weekly trends with PM and provide explanation for standard Key Performance Indicators, such as favorable/unfavorable results in revenue, visits, revenue per day, revenue per doctor day, visits per day, visits per doctor day, etc., • Collaborate with Regional Director(s) and Vice President of Medicine to handle any issues identified and or recommendations for improvement., • Monitor DEA logbooks for accuracy., • Review current projects and provide updates as needed., • Collaborate with Regional Director with operational issues or possible areas for improvement., • Review DVM numbers to identify problems and trends., • Encourage healthy communication between DVMs and guide DVM protocols and ideas., • Perform quarterly inspections of all practices in designated region., • Host regional DVM events., • DVM/VMD degree from an AVMA accredited college (or successful completion of the ECFVG or PAVE program)., • Hold Veterinary License in State(s) of all hospitals being overseen., • Active license and DEA in good standing to practice in the state(s) in which candidate will be employed (or the ability to obtain a license in that state)., • Excellent verbal and written communication skills., • Strong leadership skills and the ability to delegate responsibility when appropriate., • The ability to analyze complex information and make quality decisions that are respectful of the stakeholders involved., • The ability to work with, lead, and motivate people of various personality types., • Strong time management skills., • The ability to conduct oneself in a manner befitting the importance of the position of Veterinarian., • The ability to represent American Veterinary Group and the practice to the profession and community in a positive manner., • Clinical practice experience of 5+ years, preferred leadership experience., • Ability for high level of travel and large amounts of time away from home (company paid)., • Flexible Compensation Package (Salary only or ProSal), • Paid Travel & Housing, • Healthcare: Medical, Vision and Dental, • Twelve (12) Days Paid Time Off (PTO), • Six (6) weeks of paid Parental Leave, • One (1) Work/Life Balance day off annually, • 401k Match, • Paid Continuing Education (CE) Days, • Generous Continuing Education (CE) Allowance, • Paid State Licensing Fees, • Paid AVMA and State Professional Dues, • Short-Term and Long-Term Disability Insurance, • Life Insurance, • Professional Liability Insurance (PLIT), • Discounted Veterinary Care, • Continued Mentorship Opportunities, • Company-Wide DVM-Only Messaging Platform to Share Cases and Ideas

Job Description About Us: At Quaker Houghton, we are experts in the development, production and application of industrial process fluids, lubricants and coatings for the manufacturing industry. We have been an integral part in the growth of the world’s largest industrial and manufacturing companies from aerospace and automotive to primary metal and energy. Today, we have a global presence, with our corporate headquarters located in Conshohocken, PA. Quaker Houghton is a global publicly traded company with a unique collaborative culture that supports career growth for its colleagues and offers competitive compensation and benefit programs. Position Summary: As an Americas Regional Sr. Procurement Manager, you will be responsible for managing sourcing activities within raw material categories across the Americas region. Your primary goal is to drive scale and standardization, maximize value, reduce overall costs, and improve the quality of goods purchased across all raw material categories. In this role, you will serve as the business regional focal point for your all raw material categories, ensuring that the sourcing strategy aligns with global category managers, business, and other stakeholders. You will develop and maintain relationships with key suppliers in the region, negotiate and finalize contracts to increase value while mitigating risks acceptably. This individual is responsible for integrating raw material purchases for our specialty businesses. Additionally, you will analyze, understand, and interpret market dynamics, trends, and drivers, as well as maintain supplier databases. As a team leader, you will manage a sizeable team consisting of local category managers and Senior Sourcing Specialists, driving regional raw material synergy across countries such as United States, Canada, Mexico, Brazil and Argentina. Job Accountabilities: • Accountable for managing higher-complexity regional raw material category with a spend of up to USD $350 MM, • Support the development and execution of value-optimal category strategies that appropriately balance security of supply, cost, and other value factors, • Develop, maintain, and manage a supplier base that offers optimal quality, service, technology, and value, • Support negotiation and implementation of supply agreements that include ideal terms, • Conduct quarterly business reviews (QBRs) with key suppliers to advance supplier-supported company objectives, develop supplier capabilities, address gaps in supplier performance, • In collaboration with the BUs, Technology, and/or other functional stakeholders, develop and continuously evolve a cost savings/productivity plan for the category that includes a pipeline of new ideas, in-process projects, and projects accruing savings in support of exceeding annual savings goals, • Develop and effectively utilize should-cost models, market intelligence, and other value analysis tools to place the company in the best possible value position in the respective market, • Effectively address all supplier performance failures via the root cause and corrective action process, successfully levying claims, and other tactics as appropriate, • Develop and implement supply category strategies, applying best-in-class procurement processes and technology, managing special projects, driving procurement/supplier initiatives. The end result is to meet product, service, quality and overall supply requirements, and achieving cost savings objectives, • Ensure the team / you develop and execute RFPs/RFIs, • Develop, execute and manage supplier contracts and agreements in line with QH DOA, • Provide leadership to drive continuous improvement in spend management processes and implemented tactics to drive compliance across the company, • Continually develop strong relationships with internal business partners across the company and stay connected with their individual business strategies and needs, • Execute the defined strategic sourcing process and drive utilization of tools and techniques aligned with the process framework and architecture, • Develop deep expertise in the spend category, shares and transfers expertise to global category managers and regional sourcing professionals. Is business focal point contact for category., • Responsible for compliance with legal requirements, and with Company Procedures and policies (SOX, Quality, etc). Works with local sourcing professionals to ensure alignment with local regulations, restrictions, supply chain requirements Develop and maintain company sourcing methodology and tools, • Work effectively across business units with different objectives in the creation and implementation of procurement strategies for complex spend categories, • Develop and lead a substantial team, comprising category managers and senior sourcing specialists, to cultivate their skills in strategic sourcing and improve the standardization of sourcing approaches. Ensure the team adheres strictly to the global procurement policy., • Responsible for managing raw material cost savings and overseeing all procurement KPIs for the Americas region. Serve as the primary contact for the global direct procurement team., • Collaborate closely with the supplier development team to discover new vendors that can meet regional and global cost-saving requirements. Investigate all possibilities for sourcing raw materials from other regions., • Assess the current state of the Americas procurement organization and collaborate with the Americas procurement director to advance its structure to the next level, establishing a genuine regional category management organization. Coordinate seamlessly with the global team to ensure the global procurement operating model operates efficiently., • Bachelor's degree or higher education in Business, Chemistry, Engineering, or a related field is preferred, or an equivalent combination of education and experience. Prior experience in purchasing commodities or services within the chemical industry or a similar sector is required; Master's preferred., • 10 years of experience in procurement experience. Ideally someone with experience in Americas and global sourcing, demonstrating a successful history in formulating and implementing supplier sourcing strategies and programs, including supplier partnership/alliance concepts. People management experience is essential, along with experience in sourcing raw materials (with global experience being advantageous)., • At least 3 years working in supply chain, engineering, or an operations function. (cross functional experience within the operations umbrella)., • Competitive pay programs with excellent career growth trajectory, • Opportunities to see your efforts contribute toward the success of the business.

Job DescriptionSalary: $75,000-$85,000 Gras Lawn, a commercial landscape company, is seeking an experienced Landscape Business Developer for the Philadelphia Market. Your main responsibility is developing business with potential new customers, building and maintaining trusted relationships with key decision-makers, understanding their challenges, and creating value solutions. Your role also involves effectively identifying opportunities, gathering valuable intelligence, creating customer-centric proposals, collaborating with team members, meeting specific activity targets, and closing deals. The Business Developer focuses on strengthening Gras Lawns market presence and driving profitable growth. This position plays a key role in meeting long-term strategic objectives by fostering important customer relationships, identifying business opportunities, negotiating and closing deals, and maintaining a comprehensive understanding of the current market landscape. • Identifyandunderstandthechallengesofprospectiveclientsanddevelopsolutions., • Provideaccurateforecastsforsales,deliverables,andkeyperformanceindicators(KPIs)., • Achievesalesgoalswhilehavingtheabilitytoworkindependently., • Usesalestechniquestofindnewcustomersandbuildlong-termbusinessrelationships.Also,focusonmarketingandpricingstrategies., • Conductphoneprospecting,salespresentations,virtualdemonstrations,andcontractnegotiationswithminimalsupervision., • Identifycustomerneedsandapplysolution-basedsellingtechniquestodemonstratethevalueofGrasLawnsserviceseffectively., • Buildandnurturerelationshipswithpotentialandcurrentclients., • Planyourdailyactivitiesandaimtomeetspecificperformancebenchmarkstoclosebusinessdealssuccessfully., • ConsistentlyandreliablylogactivitiesintheCRM., • Workeffectivelyinafast-pacedenvironmentwhilemaintainingastrongsenseofurgency., • ExtensiveexperienceintheCommercialLandscapeIndustry, • Proventrackrecordofsalesgoalattainmentandpipelinemanagement, • 3-5yearsofexperienceinB2Bsalesatmid-to-seniorlevels., • Localknowledgeandcontactsinoneormoremarketsegments, • Proficientwithcomputerprograms,includingAspireandaCRMtool, • Highlycompetitive,positive,andresults-driven, • Exceptionalmultitasker., • Excellentoralandwrittencommunicationabilities,strongpresentationskills,andprofessionalexperiencewithsocialmedia., • Passionate,organized,andresourcefulindividualwithoutstandinglisteningandinterpersonalskills., • Highly organized, self-motivated, and hardworking, with effective time management capabilities., • Easilyadaptabletonewsituations., • Salary commensurate with experience., • Youwillberesponsiblefor:

Job Description Who We Are NeuroFlow CEO and West Point graduate Christopher Molaro served in the army for five years, including a tour in Iraq as a platoon leader. Coming back home, he experienced firsthand the gaps in the behavioral health system and how veterans and civilians alike face too many barriers when it comes to receiving appropriate, timely care. While pursuing his MBA at Wharton, Chris met his future co-founder Adam Pardes, and the two agreed – even the most engaging digital mental health apps in the world wouldn't truly change the problem; only a solution that systematically integrated behavioral health into the full healthcare ecosystem could create meaningful change. And so they created NeuroFlow. What We Do: We pride ourselves on partnering with healthcare leaders to assist in driving better outcomes, lowering total cost of care, and making behavioral health risk more predictable and transparent. NeuroFlow exists to make sure no one who needs behavioral health support falls through the cracks.We build more than just engaging digital health tools for self-care: we create platforms that identify population behavioral health risk early, engage individuals with acuity-specific resources, and enable care teams to make smarter and more efficient decisions. Together, NeuroFlow's solutions arm healthcare organizations with the insights they need to overcome the systemic challenges in today's healthcare ecosystem. How We Do It: The award-winning culture at NeuroFlow is one built around encouragement and daring to be great. Our core values have been displayed in our office since day one, and each team member is responsible for carrying out these values and keeping each other accountable to them. We succeed through our flexibility and agility, navigating and transforming an industry ripe for change where "no" or "can't" is too often the default. NeuroFlow offers unique opportunities to work in a fun and challenging fast-paced environment with direct, meaningful impact on helping to close the divide between mental and physical health. General Application: We are growing quickly so if one specific job doesn't stand out to you this is a great place to apply without a specific job! What We Believe: NeuroFlow is a proud equal opportunity employer. Every day we are working to tackle the mental health crisis in America, and in order to do that well, we need diverse voices, experiences, and perspectives at the table. As an equal opportunity employer, we prohibit any unlawful discrimination against a job applicant on the basis of their race, color, religion, gender, gender identity, gender expression, sexual orientation, national origin, family or parental status, disability*, age, veteran status, or any other status protected by the laws or regulations in the locations where we operate. We respect the laws enforced by the EEOC and are dedicated to going above and beyond in fostering diversity across our workplace. *Applicants with disabilities may be entitled to reasonable accommodation under the terms of the Americans with Disabilities Act and certain state or local laws. A reasonable accommodation is a change in the way things are typically done which will ensure an equal employment opportunity without imposing undue hardship on NeuroFlow. Please inform our Talent team if you need any assistance completing any forms or to otherwise participate in the application process. As a HIPAA compliant organization All team members shall: * Act in accordance with NeuroFlow's Information Security Policies. * Protect organizational assets from unauthorized access, disclosure, modification, destruction or interference. * Report security events or other risks to the organization * Execute organizational security processes or activities * Perform security responsibilities that defined and communicated for their role * Be responsible for their actions regarding the security of organization

Job Description Access Services is seeking to hire a high-energy and self-motivated Crisis Response Worker to join our Montgomery County Mobile Crisis team, with an office based out of Plymouth Meeting, PA. Montgomery County Mobile Crisis offers 24/7 support to people of all ages in difficult times. Individuals in crisis can speak with a counselor regarding mental health, addiction, trauma, etc., either by phone/video or in-person in their homes or communities. As a Crisis Response Worker, you will have the opportunity to sit and be present with people on some of the hardest days of their lives. You will be expected to work alongside teammates, supporting individual in crisis while also maintaining a supportive and growth focused team dynamic. Our team seeks to continually learn and grow together. Crisis response work is excellent, diversified experience for those looking to pursue a career in social services. You will meet people from all walks of life and have a chance to make a real impact in critical moments. You will experience the value of partnership with various providers, emergency services, schools, and teammates to support individuals and communities in times of crisis. Visit our Facebook page to get a glimpse of what we do: Visit our webpage to view a 3 minute video, and learn how we creatively serve and strengthen our community: Work Schedule: • 40 hours per week: 4 days per week, 10 hour shifts., • Schedules vary from week to week, and can occur on weekdays and/or weekends. Key Responsibilities of the Crisis Response Worker: • Provide immediate access to “hands-on” crisis support through phone counseling and mobile in-person crisis intervention., • Provide rapid and effective assessment, support, hospitalization (when necessary), linkage to community resources, crisis prevention planning, and follow up., • Develop and write action plans in a timely manner with clear and measurable outcomes., • Participate in assertive outreach to individuals identified to be high users of crisis services., • Complete progress notes and required documentation in a timely manner for each individual served. Qualifications of the Crisis Response Worker: • Bachelor’s degree in a related field such as psychology, social work, etc. (required), • Some prior work or internship experience related to mental health (strongly preferred), • Valid driver’s license with 2+ years of driving experience, reliable vehicle, and adequate car insurance (required) Compensation: • Health, Vision, Rx, & Dental insurances, HSA/FSA, 401k program., • Tuition Reimbursement Program., • 20 days PTO (vacation/sick), 7 agency holidays, 2 floating holidays., • Mileage/Toll Reimbursement, paid travel time between worksites., • Life Insurance, Short/Long Term Disability, Catastrophic Sick Leave, Paid Parental Leave., • Employee Assistance Program (telehealth/in person)., • Referral Bonuses up to $750 per hire. #CW333

Job DescriptionJoin Our Team and Grow into Leadership Are you a skilled restoration technician with 23 years of hands-on experience in water or mold remediation? Are you looking for a company that will invest in your future, help you grow your career, and recognize your hard work? AdvantaClean of Gloucester & Camden Counties is looking for a Restoration Technician who is ready to take the next step toward becoming a Lead Technician. Were a tight-knit, professional team that values accountability, quality work, and personal development. If you're dependable, mechanically inclined, and ready to lead, this is your opportunity to level up. What We Offer: • Competitive hourly wage with overtime opportunities and incentive bonuses, • Clear growth path to Lead Technician within 612 months, • Paid IICRC training toward Journeyman and Master certifications, • Paid time off and health benefit allowance, • Supportive leadership and a positive work environment, • Access to the tools, equipment, and training needed to succeedWhat Youll Do:, • Work alongside experienced team members in mold remediation, water mitigation, and indoor air quality projects, • Learn job site management, scope execution, and safety standards under IICRC S500 and S520, • Assist with equipment setup, demo work, HEPA vac and antimicrobial protocols, • Maintain job documentation, photos, and cleanliness of equipment and vehicles, • Help ensure jobs are completed to the Standard of Clean and build strong customer relationships Requirements: • 23 years of experience in water/mold restoration or construction, • Must be reliable, on time, and ready to learn and grow, • Valid drivers license with a clean driving record, • Physically able to lift 25+ lbs and work in crawlspaces, attics, and confined spaces, • Experience with IICRC WRT / ASD is a plus we will help you get certified if not Safety Gear Provided: • PPE, • Gloves (leather, nitrile, or coated cloth depending on application), • Safety Glasses or Goggles, • Half Face respirators, • Poly Spun Tyvek style suits with hood and foot protection

Job DescriptionSalary: $75,000-$85,000 Gras Lawn, a commercial landscape company, is seeking an experienced Landscape Business Developer for the South Jersey Market. Your main responsibility is developing business with potential new customers, building and maintaining trusted relationships with key decision-makers, understanding their challenges, and creating value solutions. Your role also involves effectively identifying opportunities, gathering valuable intelligence, creating customer-centric proposals, collaborating with team members, meeting specific activity targets, and closing deals. The Business Developer focuses on strengthening Gras Lawns market presence and driving profitable growth. This position plays a key role in meeting long-term strategic objectives by fostering important customer relationships, identifying business opportunities, negotiating and closing deals, and maintaining a comprehensive understanding of the current market landscape. • Identifyandunderstandthechallengesofprospectiveclientsanddevelopsolutions., • Provideaccurateforecastsforsales,deliverables,andkeyperformanceindicators(KPIs)., • Achievesalesgoalswhilehavingtheabilitytoworkindependently., • Usesalestechniquestofindnewcustomersandbuildlong-termbusinessrelationships.Also,focusonmarketingandpricingstrategies., • Conductphoneprospecting,salespresentations,virtualdemonstrations,andcontractnegotiationswithminimalsupervision., • Identifycustomerneedsandapplysolution-basedsellingtechniquestodemonstratethevalueofGrasLawnsserviceseffectively., • Buildandnurturerelationshipswithpotentialandcurrentclients., • Planyourdailyactivitiesandaimtomeetspecificperformancebenchmarkstoclosebusinessdealssuccessfully., • ConsistentlyandreliablylogactivitiesintheCRM., • Workeffectivelyinafast-pacedenvironmentwhilemaintainingastrongsenseofurgency., • ExtensiveexperienceintheCommercialLandscapeIndustry, • Proventrackrecordofsalesgoalattainmentandpipelinemanagement, • 3-5yearsofexperienceinB2Bsalesatmid-to-seniorlevels., • Localknowledgeandcontactsinoneormoremarketsegments, • Proficientwithcomputerprograms,includingAspireandaCRMtool, • Highlycompetitive,positive,andresults-driven, • Exceptionalmultitasker., • Excellentoralandwrittencommunicationabilities,strongpresentationskills,andprofessionalexperiencewithsocialmedia., • Passionate,organized,andresourcefulindividualwithoutstandinglisteningandinterpersonalskills., • Highly organized, self-motivated, and hardworking, with effective time management capabilities., • Easilyadaptabletonewsituations., • Salary commensurate with experience., • Youwillberesponsiblefor:

Job Description Overview Join a Team That Changes Lives For more than 170 years, Elwyn has been leading the way in supporting children, teens, and adults with autism, intellectual and developmental disabilities, and behavioral health challenges. As a mission-driven nonprofit, we’re here to create real change – helping people lead meaningful, fulfilling lives. Now, we’re looking for passionate team members to join us. Here, your work will change lives – including your own. You’ll make an impact every day, find purpose in what you do, and grow in a career that truly matters. At Elwyn, we take care of you while you care for others. We offer: • Generous Paid Time Off, • Comprehensive Medical/Dental/Vision Benefit Packages, • Earned Wage Access/On-Demand Pay, • Paid On-the-Job Training, • Tuition Reimbursement, • Career Advancement Opportunities and Growth, • Flexible Schedules, • Retirement Savings Plan Join us and be a part of something bigger. Apply today. Responsibilities Elwyn seeks a Regioinal Director Community Homes Maintenance to supervise and lead all maintenance and facilities staff for New Jersey, Pennsylvania and Delaware community homes. Coordinate daily operations, projects, and assignments, ensuring high standards of service, safety, and efficiency. Serve as the primary liaison between maintenance, program staff, and senior leadership. Oversee all work order (WO) activities, emergency response, and contractor management. Drive performance improvement and cost-effective operations through continuous monitoring, reporting, and process optimization. DUTIES & RESPONSIBILITIES Leadership and Supervision: • Oversee, mentor, and evaluate all maintenance and facilities staff, ensuring work is completed to the highest standards., • Conduct staff assessments, interviews, and make recommendations for hiring, promotion, and disciplinary actions., • Manage work orders, ensuring all work requests are prioritized, assigned, and completed efficiently., • Produce and review reports on work order status, backlog, and completion rates., • Upon MRI (Angus) rollout, ensure all maintenance activities are tracked and reported within the system., • Achieve and maintain an 80% work order close rate, with clear targets for response and resolution times (to be fully tracked via Angus post-rollout)., • Develop and implement performance targets for the team, including response times for emergency, high, medium, and low priority work orders such as;, • Emergency: Response within 30 minutes, resolution within 2 hours, • High Priority: Response within 2 hours, resolution within 24 hours., • Medium/Low Priority: Response within 24 hours, resolution within 72 hours., • Hold staff accountable for meeting performance targets and maintaining high standards of workmanship., • Monitor and reduce unnecessary contractor usage; track and report monthly contractor spend, with a goal of reducing contractor expenses by at least 10% over the next quarter., • Optimize resource allocation to maximize efficiency and minimize downtime., • Maintain up-to-date emergency and on-call schedules for 24/7 coverage., • Conduct regular facility audits and inspections to identify and address potential issues before they become emergencies., • Ensure timely and clear communication with program staff, senior leaders, and maintenance team regarding work order status, delays, and urgent issues., • Facilitate regular meetings with stakeholders to review performance, address concerns, and align priorities., • Ensuring homes are in compliance with all regulatory, safety, and organizational policies., • Maintain accurate documentation of all work orders, contractor invoices, and maintenance logs., • Oversee team’s emergency response protocols., • Order materials as needed. Education: • High school diploma or equivalency. Experience: • Minimum of ten (10) years working in the building trades, • Minimum of seven (7) years as a supervisor. Qualifications: • Knowledge of the standards and practices of the building trades., • Ability to read and understand blueprints., • Ability to work in all types of weather and in a climate-controlled atmosphere., • Ability to work in a fast-paced environment and manage multiple priorities., • Current, valid driver’s license in state of residence, tow (2) years driving experience, and acceptable driving record in the United States.Company DescriptionFor more than 170 years, Elwyn has been leading the way in supporting children, teens, and adults with autism, intellectual and developmental disabilities, and behavioral health challenges. As a mission-driven nonprofit, we’re here to create real change – helping people lead meaningful, fulfilling lives. Now, we’re looking for passionate team members to join us. Here, your work will change lives – including your own. You’ll make an impact every day, find purpose in what you do, and grow in a career that truly matters. At Elwyn, we take care of you while you care for others.For more than 170 years, Elwyn has been leading the way in supporting children, teens, and adults with autism, intellectual and developmental disabilities, and behavioral health challenges. As a mission-driven nonprofit, we’re here to create real change – helping people lead meaningful, fulfilling lives.\r\n\r\n\r\n\r\nNow, we’re looking for passionate team members to join us. Here, your work will change lives – including your own. You’ll make an impact every day, find purpose in what you do, and grow in a career that truly matters.\r\n\r\nAt Elwyn, we take care of you while you care for others.

Job Description Horizon House is a nationally recognized provider of services to adults with support needs due to developmental disabilities, behavioral health issues and substance abuse. With over 100 locations throughout Southeastern Pennsylvania and the state of Delaware, Horizon House provides services to a diverse population focusing on individual strengths and choices. Our Suburban Behavioral Health Services Region in Chester, PA is seeking dedicated Psychiatric Rehabilitation Worker. The Psychiatric Rehabilitation Worker provides Psychiatric Rehabilitation Services (PSR) facility-based and/or in the community as assigned, facilitates groups to enhance an individual’s knowledge to develop, enhance, and retain skills and competencies in living, learning, working and socializing. Help individuals receive the level of and/or have access to the services/supports they choose, so that an individual can live in the environment of their choice. Monitor and track progress of individuals in assigned caseload; participate in the development of individualized rehabilitation plans. Provides and facilitates individuals’ skill development and support which includes daily living, socialization, educational/vocational supports and opportunities, and leisure/recreation activities planning, including community integration and community connections. Participate in the resolution of crisis situations; assist with identifying individuals and resources that can provide direct support and/or immediate intervention during a crisis situation. Establish and maintain liaisons with other service providers to promote program coordination and enhance individual services. Requirements · Bachelors degree, or Associates degree and 1 year work experience in mental health direct service, or CPS certification and 1 year paid or volunteer experience, or a High School diploma/GED and 2 years work experience in Human Services, which must include 1 year of mental health direct service. · Must have excellent oral and written communication skills, as well as be detail-oriented and able to complete a high volume of documentation in a fast-paced environment. · Strong computer skills are required, as well as Internet research abilities. · Ability to work independently and as part of a team. · Knowledge of mental health system and supports. · Must possess a valid driver’s license with an acceptable driving record. Scope: · Frequent talking and listening. · Requires lifting and/or carrying and the ability to fold, kneel, stack, stoop and bend which may include direct client intervention. · Must be available for local travel. · May require crisis intervention for emergency situations. · Participation in on call coverage as applicable. · May be required to report to work during emergencies including inclement weather. Horizon House offers competitive compensation and a comprehensive benefit package including: medical & dental, (9) nine paid holidays, generous paid time off, tuition reimbursement, retirement savings plan, voluntary tax sheltered annuity, transit benefit program, opportunities for advancement and more. To be considered an applicant, please complete the pre-employment application. Horizon House, Inc. is an Equal Opportunity Employer

Job Description Overview Join a Team That Changes Lives For more than 170 years, Elwyn has been leading the way in supporting children, teens, and adults with autism, intellectual and developmental disabilities, and behavioral health challenges. As a mission-driven nonprofit, we’re here to create real change – helping people lead meaningful, fulfilling lives. Now, we’re looking for passionate team members to join us. Here, your work will change lives – including your own. You’ll make an impact every day, find purpose in what you do, and grow in a career that truly matters. At Elwyn, we take care of you while you care for others. We offer: • Generous Paid Time Off, • Comprehensive Medical/Dental/Vision Benefit Packages, • Earned Wage Access/On-Demand Pay, • Paid On-the-Job Training, • Tuition Reimbursement, • Career Advancement Opportunities and Growth, • Flexible Schedules, • Retirement Savings Plan Join us and be a part of something bigger. Apply today. Responsibilities Elwyn seeks a Plumbing/Maintenance Supervisor to troubleshoot, fix, repair and/or replace plumbing and steam systems as well as provide routine facility maintenance. ESSENTIAL DUTIES: • Maintains the facilities’ plumbing and steam systems including installation of new equipment, • Maintains and performs preventative maintenance (PM) in accordance with established PM schedules, • Communicates daily with supervisors and staff (via telephone and email) regarding facilities maintenance issues, • Creates and maintains work logs in accordance with Pennsylvania Department of Environmental Protection, • Arranges work orders as they are received and completes in order of priority, • Maintains stock inventory and orders materials as needed, • Maintains and updates computer database once systems have been serviced and/or replaced Responds to requests for information by accessing relevant facility files, • Provides routine building maintenance as needed, • Oversees the work activities of the Maintenance Repair Person, • Trains new hires in the department regarding handling of general work processes as well as how to handle basic plumbing issues, • Provides supervision of assigned staff in the areas including, but not limited to, recruitment, selection, leadership, coaching, training, performance management, promotion, discipline and termination, • Oversees the work activity of any plumbing contractor, • Provides back-up coverage for other maintenance supervisors as needed, • Performs On call responsibilities for building maintenance after hours, • Master Plumber license with eligibility to transfer license to Middletown Township, Pennsylvania, • Five (5) years’ experience as a plumber, • One (1) year providing supervision preferred, • Experience working in building trades preferred, • Ability to read and understand blueprints preferred, • Knowledge of and proficient in relevant computer systems related to the field, • Demonstrated ability to work effectively as part of a team, • Must possess excellent customer interaction and written and verbal communication skills, • Must possess a current, valid driver's license in state of residence, have a minimum of two (2) years of driving experience within the United States, and have an acceptable driving record.Company DescriptionFor more than 170 years, Elwyn has been leading the way in supporting children, teens, and adults with autism, intellectual and developmental disabilities, and behavioral health challenges. As a mission-driven nonprofit, we’re here to create real change – helping people lead meaningful, fulfilling lives. Now, we’re looking for passionate team members to join us. Here, your work will change lives – including your own. You’ll make an impact every day, find purpose in what you do, and grow in a career that truly matters. At Elwyn, we take care of you while you care for others.For more than 170 years, Elwyn has been leading the way in supporting children, teens, and adults with autism, intellectual and developmental disabilities, and behavioral health challenges. As a mission-driven nonprofit, we’re here to create real change – helping people lead meaningful, fulfilling lives.\r\n\r\n\r\n\r\nNow, we’re looking for passionate team members to join us. Here, your work will change lives – including your own. You’ll make an impact every day, find purpose in what you do, and grow in a career that truly matters.\r\n\r\nAt Elwyn, we take care of you while you care for others.

Job Description Horizon House, Inc. is a nationally recognized provider of services to adults with support needs due to develop mental disabilities, behavioral health issues, and substance abuse. Horizon House is Pennsylvania’s oldest psychiatric rehabilitation agency. Since 1952, we have been dedicated to helping people with mental illness, drug and alcohol addictions, developmental/intellectual disabilities, and homelessness to stabilize their lives and to help them live as independently as possible in the community. With over 100 locations throughout South and North Eastern Pennsylvania and the state of Delaware, Horizon House provides services to adverse population focusing on individual strength and choice. We are seeking qualified candidates for the position of Licensed Practical Nurse (LPN). The LPN will provide management and administration of medication in conjunction with the staff Psychiatrist. Will assist psychiatrists with: insurance prior authorization process from completing the forms to notifying the participant when insurance gives the approval; developing and implementing a system to ensure participants have prescribed laboratory tests including how to ensure psychiatrist receives and reviews the results; work with other nurses in the department to facilitate an efficient flow of information from and to the psychiatrists. Will provide arrange of treatment, rehabilitation and support service consistent with physician orders and standard nursing practices. Will provide services incompliance with contract and Agency regulations. Other responsibilities include the following: • Monitor participant’s medication. Verify insurance for medication approval by making phone calls and completing authorization requests to appropriate insurance companies and pharmacies as directed by psychiatrist., • Provide basic nursing care, provide symptom management education, ensure immediate changes are made in the treatment plans as participants’ needs change; educate and support participants’ families, and advocate for participants’ rights and preferences., • Submit accurate and timely documentation and related information in accordance with TCMU/CBH/HH standards. Document all contacts, movement, growth, transfers and overall progression through the system, in accordance with funding source regulations., • Oversee the maintenance of the medication room area. Monitor and order needed supplies., • Board Certified Licensed LPN in the State of PA., • Prior experience in servicing community mental health facilities., • Comprehensive knowledge of psychiatric clinical and psychosocial rehabilitation practices. Excellent communication skills, both oral and written; Detail oriented., • Strong interpersonal skills; Team oriented; Very strong organization and analytical skills., • Must be available for scheduled emergency on-call service., • Frequent talking and listening., • May require verbal crisis intervention assistance in emergency situations., • Must be available for local travel and possess a valid driver’s license with an acceptable driving record., • Scheduling flexibility and possible on-call work are necessary. Horizon House, Inc. is an Equal Opportunity Employer Company DescriptionHorizon House, Inc. is a nationally recognized provider of services to individuals with support needs due to developmental disabilities, behavioral health issues, and substance abuse. Horizon House is Pennsylvania’s oldest psychiatric rehabilitation agency. Since 1952, we have been dedicated to helping people with mental illness, drug and alcohol addictions, developmental/intellectual disabilities, and homelessness to stabilize their lives and to help them live as independently as possible in the community. With over 100 locations throughout South and North Eastern Pennsylvania and the state of Delaware, Horizon House provides services to a diverse population focusing on individual strength and choice.Horizon House, Inc. is a nationally recognized provider of services to individuals with support needs due to developmental disabilities, behavioral health issues, and substance abuse. Horizon House is Pennsylvania’s oldest psychiatric rehabilitation agency. Since 1952, we have been dedicated to helping people with mental illness, drug and alcohol addictions, developmental/intellectual disabilities, and homelessness to stabilize their lives and to help them live as independently as possible in the community. With over 100 locations throughout South and North Eastern Pennsylvania and the state of Delaware, Horizon House provides services to a diverse population focusing on individual strength and choice.

Job Description Horizon House, Inc. is a nationally recognized provider of services to adults with support needs due to developmental disabilities, behavioral health issues, and substance abuse. Horizon House is Pennsylvania’s oldest psychiatric rehabilitation agency. Since 1952, we have been dedicated to helping people with mental illness, drug and alcohol addictions, developmental/intellectual disabilities, and homelessness to stabilize their lives and to help them live as independently as possible in the community. With over 100 locations throughout South and North Eastern Pennsylvania and the state of Delaware, Horizon House provides services to a diverse population focusing on individual strength and choice. Currently, we are seeking a full time Recovery Coach to work in our Behavioral Health Services Division. Scope: · Must be available for local travel. · Requires flexibility in scheduling and ability to do 24 hour on-call coverage. · Requires ability to speak clearly, hear easily. · Requires ability to lift, carry, fold, kneel, reach, stack, stoop, bend and climb stairs. · May be required to report to work during emergencies including inclement weather. Horizon House offers competitive compensation and a comprehensive benefit package including: medical & dental, (9) nine paid holidays, generous paid time off, tuition reimbursement, retirement savings plan, voluntary tax sheltered annuity, transit benefit program, opportunities for advancement and more. To be considered an applicant, please you can apply at and click on the careers tab. Horizon House, Inc. is an Equal Opportunity Employer Company DescriptionHorizon House, Inc. is a nationally recognized provider of services to individuals with support needs due to developmental disabilities, behavioral health issues, and substance abuse. Horizon House is Pennsylvania’s oldest psychiatric rehabilitation agency. Since 1952, we have been dedicated to helping people with mental illness, drug and alcohol addictions, developmental/intellectual disabilities, and homelessness to stabilize their lives and to help them live as independently as possible in the community. With over 100 locations throughout South and North Eastern Pennsylvania and the state of Delaware, Horizon House provides services to a diverse population focusing on individual strength and choice.Horizon House, Inc. is a nationally recognized provider of services to individuals with support needs due to developmental disabilities, behavioral health issues, and substance abuse. Horizon House is Pennsylvania’s oldest psychiatric rehabilitation agency. Since 1952, we have been dedicated to helping people with mental illness, drug and alcohol addictions, developmental/intellectual disabilities, and homelessness to stabilize their lives and to help them live as independently as possible in the community. With over 100 locations throughout South and North Eastern Pennsylvania and the state of Delaware, Horizon House provides services to a diverse population focusing on individual strength and choice.

Job Description JOB SUMMARY Gunton Corporation, the largest independent distributor of Pella Windows & Doors in the country, is an innovative leader in our industry. Our Sales Representatives provide solutions for our customers' window and door needs and are key to our success since 1932. Due to our continued growth, we are actively expanding our Outside Sales Team that calls on local builders, contractors, remodelers, and replacement companies. Come be a part of our exciting growth! TERRITORY We love when our Sales Reps live in the territory they sell. This territory is centered around our showroom located in Plymouth Meeting, PA. RESPONSIBILITIES • Develop and execute a business plan that will establish activity levels and target account acquisitions for the upcoming year to allow you to achieve your sales goals., • Focus on new account acquisition, targeting local builders, contractors, remodelers, and replacement companies to drive results and meet established goals., • Regularly visit permit offices or review permit reports to uncover active new projects and accounts in your area., • Participate in select functions, such as trade shows or chapter meetings, to build your network and relationships with prospective clients., • Continually update and leverage knowledge of Pella and competitor products., • Complete take-offs when applicable; Develop window and door solutions to satisfy prospects and customers’ needs., • Always exhibit the highest standard of personal ethics and adhere to all Gunton Corporation policies. REPORTING RELATIONSHIP Reports to Area Sales Manager MINIMUM QUALIFICATIONS • A valid driver’s license and acceptable driving record, • Ability to lift and carry sales tools that could weigh up to 50 pounds PREFERRED QUALIFICATIONS • One (1) year of experience cold calling as a form of business development, • College degree, • Experience in Outside Sales, • Experience in Construction WHAT WE OFFER • No Overnight Travel, • Small Geographical Territories, • Paid Training, • Vehicle Allowance, • Phone and Laptop, • Paid Vacation, • Insurance (Health, Vision, Dental, Life), • Flexible Spending Account, • 401(k), • Profit Sharing Gunton Corporation is pleased to be an equal employment employer. Decisions concerning employment, transfers, and promotions are made upon the basis of the best qualified candidate without regard to color, race, religion, national origin, age, sex, sexual orientation, marital status, ancestry, status as a disabled or Vietnam era veteran or any other characteristic protected by law. Company DescriptionAt Pella Gunton, we have been dedicated to making our communities a more beautiful place to live, work, and play since 1932. As the leading independent distributor of Pella Windows & Doors, our employees make a difference in the lives of our customers. Join us to be a part of our growth, longevity, and industry leadership. Together, we can deliver the quality our communities expect! We have offices and customer experience centers throughout Northeast Ohio, Pennsylvania, Delaware and New Jersey.At Pella Gunton, we have been dedicated to making our communities a more beautiful place to live, work, and play since 1932. As the leading independent distributor of Pella Windows & Doors, our employees make a difference in the lives of our customers. Join us to be a part of our growth, longevity, and industry leadership. Together, we can deliver the quality our communities expect!\r\n\r\nWe have offices and customer experience centers throughout Northeast Ohio, Pennsylvania, Delaware and New Jersey.

Job Description Kreyco (formerly known as LLN) is a nationwide organization that specializes in PK-12 world language education. We support language learners of all kinds by connecting schools nationwide to teachers for Spanish, French, Italian, German, Mandarin, Japanese, Arabic, American Sign Language (ASL), and more. Our schools and students are our driving force, and as we seek to meet their needs, we are searching for language teachers of all sorts. We are beginning our search for on-site K-12 French teaching opportunities for the 2025-2026 school year. If you are interested, please apply, and we will be in touch should an opportunity arise in your area. Compensation varies and depends on your teaching project, ranging from $400 to $1,200 weekly. Daytime teaching availability is required. No night or weekend classes! Kreyco ensures that all of our teachers have everything they need to be successful in their classrooms. This includes providing a comprehensive curriculum to our teachers, connecting them to supervisors and mentors in our network, and offering numerous professional development opportunities completely free of charge. Kreyco always has our teachers' backs! Our team is constantly growing as more and more schools reach out, hoping to offer language instruction to their students. As our network of schools expands nationwide, so does our network of teachers. We are always seeking qualified teachers to join our team. Kreyco teachers are qualified, passionate, and dedicated educators. Our teachers may come from diverse backgrounds, with work experience in a wide range of careers, but all share a common goal: they believe in the positive impact that learning a second language can have on our students. If this belief resonates with you, Kreyco may be your new professional home. Job Summary: • Job Location: On-site, • Schedule: M-F, daytime teaching hours, • Employment Type: Independent contractor You can learn more about Kreyco and what it is like to work with us by following this link to watch a short video: Kreyco is hiring! We look forward to hearing from you soon! Requirements • Bachelor's degree, • Authorized to work in the United States, • Ability to commute, • Professional development

Job Description Kreyco (formerly known as LLN) is a nationwide organization that specializes in PK-12 world language education. We support language learners of all kinds by connecting schools nationwide to teachers for Spanish, French, Italian, German, Mandarin, Japanese, Arabic, American Sign Language (ASL), and more. Our schools and students are our driving force, and as we seek to meet their needs, we are searching for language teachers of all sorts. We are beginning our search for on-site Bilingual Special Education Life Skills teachers for the 2025-2026 school year. If you are interested, please apply, and we will be in touch should an opportunity arise in your area. Compensation varies and depends on your teaching project, ranging from $400 to $1,200 weekly. Daytime teaching availability is required. No night or weekend classes! Kreyco ensures that all of our teachers have everything they need to be successful in their classrooms. This includes providing a comprehensive curriculum to our teachers, connecting them to supervisors and mentors in our network, and offering numerous professional development opportunities completely free of charge. Kreyco always has our teachers' backs! Our team is constantly growing as more and more schools reach out, hoping to offer language instruction to their students. As our network of schools expands nationwide, so does our network of teachers. We are always seeking qualified teachers to join our team. Kreyco teachers are qualified, passionate, and dedicated educators. Our teachers may come from diverse backgrounds, with work experience in a wide range of careers, but all share a common goal: they believe in the positive impact that learning a second language can have on our students. If this belief resonates with you, Kreyco may be your new professional home. Job Summary: • Job Location: On-site, • Schedule: M-F, daytime teaching hours, • Employment Type: Independent contractor You can learn more about Kreyco and what it is like to work with us by following this link to watch a short video: Kreyco is hiring! We look forward to hearing from you soon! Requirements • Bachelor's degree, • Authorized to work in the United States, • Ability to commute, • Professional development

Job Description Job Purpose Summary: • Activity Coordination, • BHT Management, • Crisis/Behavioral Management, • BHT Shift Scheduling, • Monitoring and approving time off for BHTs, • Managing call outs and shift coverage, • Administer Urine analysis and breathalyzers as needed, • Organizing events for current clients, • Aiding in implementation of BHT/Clinical behavioral interventions, • Responding to immediate crisis needs with clients, • Attends Huddle meetings and provides day to day reports, • On-Call/After-Hours Phone coverage and availability, as needed Job Type: Full-time Required education: N/A Required experience: BHT Certification, 2-4 years' experience working in a mental health facility Proper Knowledge and Skills: • Proper English and grammar, usage and spelling, • Software application related to the field, • General offices principles and practices, • Basic computer knowledge including email etiquette, • Must be able to lift 20-50 lbs., • Occasional to frequent walking, sitting, standing, driving, • Communicable diseases, • Hot/cold temperatures Can obtain through Victory Bay after hiring if not obtained prior. • Current CPR Certification, • Narcan training

Job Description The Enrollment Specialist is primarily responsible for conducting electronic fingerprinting functions according to the commercial, state or federal client’s program requirements. This is an entry-level role that introduces the incumbent to various background screening processes, including the operation of various fingerprinting equipment and navigating through specialized computer software databases. This role interfaces with our clients and their applicants for daily processing, requiring good client –focus and problem solving skills. Some specific responsibilities include, but are not limited to: • Promptly greet applicants and guests, • Facilitate applicant processing, • Perform accurate data entry, • Perform basic maintenance and troubleshoot issues with fingerprinting equipment, including computer hardware and software, • Obtain successful applicant fingerprint images and capture biometric information to meet or exceed program standards, • Travel to client locations to conduct mobile fingerprint collection, • Verify applicant identity and scan required documents into database system, • Successfully complete required biometric and data capture processes and paperwork on each applicant, • Adhere to all company and departmental employment policies, • Customer service experience, • Proficiency in Microsoft Office Suite is required, • Previous experience processing credentials preferred, • Knowledge of basic business terminology and office procedures, • Above average people skills, • Enjoy working in a team environment, • Minimum one (1) year applicable experience, • Some weekend work may be required, • High school diploma or equivalent degree Company DescriptionAn award winning company recognized for its innovation and client focus in conducting nationwide background screening and human resource consulting. First Contact HR specializes in fast, accurate and streamlined reporting of background screening reports and other services including drug testing, criminal records research, credit reports, driving records, employment and education verifications, job fit assessments, workforce training, and HR policy and procedure development.An award winning company recognized for its innovation and client focus in conducting nationwide background screening and human resource consulting. First Contact HR specializes in fast, accurate and streamlined reporting of background screening reports and other services including drug testing, criminal records research, credit reports, driving records, employment and education verifications, job fit assessments, workforce training, and HR policy and procedure development.

Job Description Are you a motivated and ambitious individual looking to start your career in business, sales, and management? Our company is seeking an Account Management Trainee to join our growing team. Our Account Management Trainee role offers hands-on experience in business operations, sales, and leadership. It is designed to develop your skills in business and management, this program will prepare you to take on sales leadership roles while working with industry-leading brand partners. Key Responsibilities of an Account Management Trainee: • Build and maintain strong relationships with clients by providing exceptional service and tailored solutions., • Execute direct, retail sales campaigns to increase client revenue and improve market position in an assigned territory., • Support sales and business development efforts by executing retail sales campaigns, identifying new opportunities and driving revenue growth for assigned accounts., • Assist in managing day-to-day business operations while learning key aspects of sales strategy, client communications, and performance analysis., • Collaborate with internal teams to coordinate marketing, sales, and operational support that align with client needs and business goals., • Participate in client meetings, supporting the sales team in presentations, account reviews, and issue resolution., • Learn to recruit, train, and develop future team members, while enhancing your leadership and team management skills., • Analyze sales data, prepare reports, and present performance insights to guide business decisions and improve outcomes., • College graduate or 0-2 years of experience in sales, business, or a related field, • Strong desire to pursue a career in business, management, and sales, • Excellent communication, organizational, and leadership skills, • Self-motivated, • Eager attitude towards learning and development in management and business, • Hands-on training in business management, sales, and leadership, • Opportunities for rapid career advancement into management roles for successful Account Management Trainees, • A collaborative business environment focused on professional growth, • Competitive compensation package with, • Performance-based bonuses

Job Description Here at The Arc Gloucester, we offer the unique opportunity to combine your professional experience with your passion to help individuals with intellectual or development disabilities For 65 years The Arc Gloucester has provided innovative programs and services to individuals with intellectual and developmental disabilities. We have made a difference in the lives of many people and are very proud of that. But it's the individuals we service who bring our programs to life with their creativity, excitement, humor, talent, and so much more! Benefits: The Arc Gloucester offers a comprehensive compensation package that includes healthcare benefits (group medical, dental and vision plans), pet insurance, employer contribution retirement plans, and time off benefits, including paid time for vacation, personal, sick, Holiday pay, jury duty & bereavement. Employees are also eligible for tuition discounts at select local colleges. Excellent Benefits Package: • Competitive pay, • Referral Bonuses, • Health Insurance (Medical, Dental, Vision), • Pet Insurance, • Paid Time Off, • Holiday pay The position is exempt with flexible hours (primarily occurring on weekdays). Travel between facilities and within the community required. Qualifications: • Master’s degree, • Board certification, active and in good standing, • 1-2 years of relevant experience, • Knowledge or experience with supporting individuals with intellectual and developmental disabilities is preferred, • Knowledge of current treatment methodologies, • Knowledge of Crisis Management Training, the Kevin Walsh method preferred, • Proven ability to work independently, • Experience with researching and gathering objective & Accurate information, preferred, • Must have a current, non-probationary driver’s license with 5 points or less, and deemed acceptable to drive by The Arc Gloucester’s liability insurance company, • Excellent computer, math, reading comprehension and verbal and written communication skills, • Successfully pass initial and ongoing State/Federal Criminal Background checks, including but not limited to Fingerprinting, CARI checks, Central Registry checks, MVR and drug screens, • Certified in CPR/First Aid While performing the essential functions of this position, the following are required, with or without reasonable accommodation: • Ability to sit, drive, stand and walk for extended periods of time, • Ability to operate a computers, phone and other relevant technology, • Physical duties, including but not limited to carrying, driving, general lifting, bending, squatting, and climbing stairs

Job Description Overview SP+, a Metropolis company, is an artificial intelligence company for the real world. We use computer vision to enable checkout-free parking experiences. So there’s no fumbling with tickets, machines, apps, or credit cards. You just “drive in and drive out.” We are the largest parking network in America, with over 23,000 employees powering mobility at over 4,000 locations across North America and Europe. Today, we are reinventing parking. Because it’s important, it's everywhere and impacts everyone. Tomorrow, we will power checkout-free experiences anywhere you go to make the everyday experiences of living, working, and playing remarkable - giving us back our most valuable asset, time. Responsibilities Basic Function: Properly utilize machine scrubbers, sweepers and power washers to clean parking garages and other various job sites. • Load and affix pressure washing equipment to truck;, • Fill tanks with water and chemicals and allow to heat;, • Lay out hoses to begin project;, • Affix spray gun to the hoses;, • Wash floors, walls, stairs, pavement, surface lots and parking garages, ensuring that hoses do not become tangled and efficiently complete jobs., • Properly dispose of/remove waste water and barricade necessary drains’ ensuring that all work performed is EPA compliant., • Maintain all equipment and provide quality service at every job., • Perform quality maintenance inspections and repairs on all assigned projects, vehicles and equipment., • Employee must wear appropriate safety equipment, including boots and gloves., • If applicable, landscaping during seasonal months and snow removal during winter months. Qualifications Qualification Requirements: To perform this job successfully, an individual must be able to perform each essential duty satisfactorily. The requirements listed below are representative of the knowledge, skill, and/or ability required. Reasonable accommodations may be made to enable individuals with disabilities to perform the essential functions. Education/Experience Required: Graduation from high school, GED or equivalent. Applicants must know how to run pressure washing equipment (hot/cold). License Requirement: Must possess a valid state-issued driver’s license with a current address and acceptable driving record. Availability to Work: Special shift requirements, if any, will vary depending on a location's hiring needs. If applicable, availability to work 2nd shift, 3rd shift and/or week-ends may be required. Language Skills: Ability to read and comprehend simple instructions, short correspondence, and memos. Ability to write simple correspondence. Ability to effectively present information in one-on-one situations to customers and other employees of the company. Appearance: Employees will be required to maintain a neat and clean appearance and be in complete uniform at all times. Physical Demands: The physical demands described here are representative of those that must be met by an employee to successfully perform the essential functions of this job. Reasonable accommodations may be made to enable individuals with disabilities to perform the essential functions. Employees are regularly exposed to outside weather conditions including snow storms, and extreme heat. • Regularly required to bend, sit, stand, squat, stoop, walk, push, pull, reach with hands and arms at shoulder level or below, use hands to finger, handle and/or feel objects, tools or controls and speak., • Occasionally required to kneel, climb and reach with hands and arms above shoulder level, lift up to 60 pounds., • Always required to wear the appropriate safety equipment for the task, which may include gloves, goggles, aprons, belts, etc. Salary Range: $15.00 per hour Benefits: Eligible employees will participate in the various benefits plans including medical, dental, vision, flexible spending accounts, long/short term disability, life insurance, accident insurance, 401k and paid time off. SP+ is an equal opportunity employer committed in policy and practice to recruit, hire, train, and promote, in all job classifications, without regard to race, color, ancestry, religion, sex, age, national origin, citizenship status, marital status, sexual orientation, veteran status, gender identity, disability or other classes protected by federal or state law. SP+ does not tolerate harassment or retaliation against any employee or applicant based on these characteristics or because the individual exercised their EEO rights. Right to Work Poster SP+, a Metropolis Company, may utilize an automated employment decision tool (AEDT) to assess or evaluate your candidacy for employment or promotion. AEDTs are used to assist in assessing a candidate’s application relative to the required job qualifications and responsibilities listed in the job posting. As part of this process, SP+ retains data relevant to your candidacy, including personal information, for a period that is reasonably necessary for the use of the tool. If you are hired for the position, your data may become part of your employee records. If you are an applicant to a New York City job posting and wish to request an alternative selection process accommodation or have questions about our data retention policy, please contact . We are here to assist you.

Job DescriptionThe CLHI Garden & Greenspaces Coordinator will develop local gardens by hands-on growing, coordinating community outreach and garden volunteer days, and providing educational programming and technical assistance to residents about gardening and greenspaces. The position requires good interpersonal skills, community organizing experience and a passion for gardening education and food justice. The anticipated schedule for this position is Tuesday to Saturday during the growing season (March October). The work week is anticipated to be 24 hours with some overtime as approved. During the off-season, we anticipate planning and other activities up to 20 hours per month. To accommodate community members schedules and special events, a typical schedule may include work hours on one or two evenings each week. This is a tremendous opportunity for a team-oriented, creative and detailed person to lead community development and strengthen the capacity of a well-respected, high-impact organization and its partners. Responsibilities • Provide expertise in planning garden and greenspace activities, • Serve as the primary point of contact for and maintain communication with CLHI community garden groups and partners through email, phone, and social media, • Coordinate and facilitate planning meetings to design, build, and maintain the gardens, • Lead staff and volunteers to build garden infrastructure, • Support community garden and greenspace leaders at each site in managing day-to-day gardening activities and challenges, • Conduct regular site visits at each garden to assess plant health, deliver materials, etc., • Lead - and facilitate others in leading - regular on-site and online educational opportunities for residents, • Represent CLHI at relevant community events, • Assist with various fundraising activities for CLHI as directed, • Make purchases and coordinate deliveries for each project, • Develop and manage budgets for each assigned project, • Demonstrated experience and ability to develop reports and manage data collection to evaluate programs impacts, • Document community engagement with photos, quotes, etc., • Assist CLHI team in maintaining social media presence by providing photos and materials for CLHIs social media and email newsletter, • Track hours and mileage for work-related travel, • Demonstrate strong time management, • Excellent written and verbal communication and relationship-building skills, • Enthusiasm and team building spirit, • Significant experience with community organizing and community outreach to many demographics, e.g., youth, elders, people of color, immigrants, economically-diverse, • Experience in gardening, food growing, • Ability to teach gardening concepts to a variety of learners, • Some experience in carpentry and/or landscaping, • Strong planning and organizational skills, including events and volunteer management, • Ability to manage several task lists at once and adapt to changing conditions, • Ability to work outdoors in all weather (heat, humidity, rain and cold) and do manual labor, • Willingness to work independently and also cooperate as part of a team, • Experience with MS Word, PowerPoint, Excel and willingness to learn other computer-based skills, • Excellent written and oral communication skills, • Regular access to a reliable vehicle this position may require substantial driving, • Positive attitude; engaging personality, • An understanding of and commitment to community engagement, food justice and CLHIs values, • Historical understanding of North Camden, Camden, NJ land use planning and social movements is a plusAbility to speak/write fluent Spanish is a plus

Job Description We're looking for a courteous, detail-oriented maintenance engineer to provide our guests with a five-star experience. You'll be in charge of overseeing the property’s overall upkeep and carrying out routine processes to make it fully functioning, pleasurable, and safe. Candidates for this position must be active, imaginative, and consistent in their commitment to assist our guests. If this describes you, we'd want to hear from you. If you’re a problem solver ready for a career in the hospitality field, apply today! Responsibilities: • Work in collaboration with other technicians who will assist you with a variety of maintenance tasks, • Complete all work orders and fix maintenance problems promptly, • Use a wide range of tools such as hammers, screwdrivers, indicators, edge finders, drills, wrenches, and additional equipment, • Maintain all of the hotel's equipment and preventative maintenance plans, • Keep an open line of communication with other team members and staffQualifications:, • You will need 2-4 years of experience in a maintenance role, • Valid driver’s license and good driving record required, • Ability to use web-based software, including facilities maintenance software preferred, • Must have a high school diploma or the equivalent GED, • Stellar communication, organizational, and interpersonal skills are neededAbout Company Stylishly renovated and well-located, Delta Hotel by Marriott Philadelphia Airport is the perfect destination for your Philly adventure. You will find our hotel less than one mile from Philadelphia International Airport and a short drive from the city's downtown district. Grab a hot breakfast and lunch to go at the Market, or sit down for breakfast, dinner, or a beverage at Lounge 1643. Host flawless meetings, weddings, and social events in one of our 15 elegantly appointed venues, enhanced by expert planners and custom catering. In the mood to explore. Head into downtown Philadelphia and get to know some of the city's most noteworthy attractions, from the Liberty Bell to the University of Pennsylvania. Whatever your reason for visiting, Delta Hotel Philadelphia Airport offers all the essentials you need for your stay in the City of Brotherly Love.

Job Description Who We Are: At Veranova, we believe people are our most important asset, and we are dedicated to building the most talented workforce in our industry. Our commitment to uncompromising focus on quality, compliance, safety, and excellence in delivery shapes everything we do. We are not just looking for skills; we are seeking innovative individuals who have a mindset open to learning and growth, and a desire to make a difference. Veranova is a global leader in the development and manufacturing of complex active pharmaceutical ingredients (APIs) for pharma and biotech customers. With deep technical expertise and impressive flexibility, we develop solutions and processes that support and accelerate innovation. Join us on our mission to enable current and next-generation therapeutics to improve and save the lives of patients. Role Overview: The Cleaning Validation Specialist is the site SME responsible for coordinating all cleaning validation and verification activities related to intermediate and API manufacturing, including facility surfaces and equipment. This role involves close collaboration with various departments to ensure compliance with regulatory and customer requirements while implementing effective cleaning strategies across the site. The position is integral to maintaining quality and safety standards in the manufacturing process, supporting both current operations and customer needs. The role is also responsible for managing the environmental and purified water monitoring programs to ensure product quality and safety throughout the manufacturing process. Core Responsibilities: • Lead the development, execution, and validation of cleaning procedures for equipment, production lines, and facilities., • Write and review cleaning validation protocols and reports in compliance with regulatory requirements, ensuring that all materials are free of any residues or contaminants., • Coordinate and conduct sampling (e.g., swab, rinse, and surface) and analytical testing to validate cleaning processes and confirm cleaning effectiveness., • Develop and maintain cleaning validation schedules to ensure timely completion of required validations, • Review cleaning validation data, ensuring it meets established acceptance criteria, and make recommendations for process improvements. Qualifications: Required • Minimum 7 years of quality assurance experience with an undergraduate degree in engineering, science or related field, • Minimum of 3 years of experience in contamination control, cleaning validation, environmental monitoring, and/or purified water systems, preferably in a pharmaceutical or biotech manufacturing environment (API CDMO experience is highly desirable), • Proven leadership experience in pharmaceutical, API/intermediate, medical device, biologics or related FDA industry, • Strong knowledge of cGMP, FDA, EMA, ICH guidelines, and other regulatory standards related to contamination control, cleaning validation, environmental monitoring, and purified water systems, • Experience with microbiological sampling, environmental monitoring, and testing of purified water systems in a regulated pharmaceutical environment, • Proficiency with risk assessment tools such as FMEA., • Previous experience working in cross-functional and project-based environments., • Experience creating metrics for driving continuous improvement, • Excellent analytical, written and verbal communication and presentation skills, • Hands-on experience with cleaning validation, TOC analysis, and bioburden reduction strategies, • Driven and detail-oriented, with a strong understanding of cGMP regulations and previous experience in cleaning validation, • Experience driving complex projects with the ability to initiate, prioritize, and successfully complete tasks, • A mindset that promotes a positive work culture, • The ideal candidate will have hands-on experience with sterile and cleaning validation processes, strong technical writing skills, and the ability to execute validation protocols independently, • Certification in contamination control (e.g., PDA Certification in Contamination Control)., • Knowledge of risk-based approaches to cleaning validation (e.g., Risk Assessment and ICH Q9), • Experience with continuous improvement methodologies such as Lean or Six Sigma desire, • Familiarity with environmental monitoring equipment and purified water system design and validation Our Commitment: • Health & Wellness: Comprehensive health & Wellness benefits. Access to mental health resources and wellness programs. Generous PTO and holiday pay policies., • Financial Wellness: Comprehensive total compensation package that includes competitive base salary, Defined Contribution Pension program, eligibility for performance-based bonuses, and attractive 401(k) Plan with company match., • Professional Development: Opportunities for continuous learning through LinkedIn Learning, workshops, conferences, and mentorship. Tuition Assistance for Undergraduate and Graduate degree programs. At Veranova, we are on a misson to meet people that believe in our values and can contribute to the team in a variety of ways. Please visit to view all open roles and join our Talent Community to stay connected and learn about opportunities as they arise. We value a range of experiences and perspectives. If you want to be part of improving and saving the lives of patients, we encourage you to apply regardless of whether you meet every qualification listed. For applicants who may require a reasonable accommodation for any part of the application or hiring process due to a disability, you may submit your request by sending an email to in order to confirm your request for an accommodation. Please include the job number, title, and location of role. This option is reserved for individuals who require accommodation due to a disability. Information received will be processed by a U.S. Veranova employee and then routed to a local recruiter who will provide assistance to ensure appropriate consideration in the application or hiring process. Additional Information: Applicants for this role must be authorized to work in the United States without further employer sponsorship. Agency and Search Firm Representatives: Veranova does not accept unsolicited resumes from agencies and/or search firms for this job posting. Important Notice Regarding Recruitment Scams: Veranova is committed to providing a professional and secure recruitment experience for all applicants. Unfortunately, fraudulent job postings and recruitment scams are becoming more prevalent. We want to ensure that all candidates are aware of potential scams. Please see our notice here. • Legitimate communications from Veranova will only come from official email addresses using our domain: @veranova.com., • Legitimate LinkedIn communications will only come from active Veranova employees., • Veranova will never ask candidates for sensitive personal information during the application process (e.g., bank account details or social security number). All your information will be kept confidential according to EEO guidelines. Veranova is an Equal Opportunity Employer. It is the policy of Veranova to provide equal employment access and opportunity to all persons regardless of age, race, color, national origin, religion, sex, sexual orientation, gender identity and/or expression, physical or mental disability, genetic information, citizenship, marital status, veteran status, or any other characteristic protected by federal, state, or local law. All applications are carefully considered, and your details will be stored on our secure Application Management System. This is used throughout Veranova for the selection of suitable candidates for our vacancies as they arise. Veranova respects your privacy and is committed to protecting your personal information. For more information about how your personal data is used please view our privacy notice.

Job Description Role:MuleSoft Architect Location: 4 Days a Week 1st Preferences: Mount Laurel,NJ/New York,NY/Farmington Hills,MI 2nd Preference: Charlotte,NC/Fort Lauderdale,FL. Please enter candidate location and location preference in the Supplier Notes or they will not be considered. Top 3 Skills: 1. MuleSoft, MuleSoft Application Networks, MuleSoft Flow Design, MuleSoft Integration, 2. API Knowledge, 3. Troubleshooting Skills, BFS Domain knowledge Summary: We are seeking a Technical Lead with 6 to 10 years of experience in MuleSoft API-Led Connect and a strong background in Life and Annuities Insurance as well as Property & Casualty Insurance. The role involves leading technical initiatives, ensuring seamless integration, and enhancing our API lifecycle management. This hybrid position requires a proactive individual who can drive innovation and efficiency in our day-to-day operations. Lead the design and implementation of MuleSoft API solutions to support business objectives and enhance system integration. Roles and Responsibility: Oversee the development and deployment of API-led connectivity solutions, ensuring alignment with industry best practices. Provide technical expertise in MuleSoft API Lifecycle management, optimizing processes for improved efficiency. Collaborate with cross-functional teams to ensure seamless integration of systems within the Life and Annuities Insurance domain. Drive innovation by identifying opportunities for process improvements and implementing cutting-edge technologies. Ensure compliance with industry standards and regulations in the Property & Casualty Insurance sector. Mentor and guide team members, fostering a collaborative and knowledge-sharing environment. Monitor and troubleshoot API performance, implementing solutions to enhance system reliability and performance. Develop and maintain comprehensive documentation for all API-related processes and solutions. Engage with stakeholders to gather requirements and translate them into technical specifications. Facilitate workshops and training sessions to enhance team capabilities and understanding of MuleSoft technologies. Evaluate and recommend new tools and technologies to improve the API development lifecycle. Contribute to the company's purpose by driving technological advancements that positively impact society.

Job Description Kreyco (formerly known as LLN) is a nationwide organization that specializes in PK-12 world language education. We support language learners of all kinds by connecting schools nationwide to teachers for Spanish, French, Italian, German, Mandarin, Japanese, Arabic, American Sign Language (ASL), and more. Our schools and students are our driving force, and as we seek to meet their needs, we are searching for language teachers of all sorts. Currently, we have an ELD Math Teacher Middle School teaching opportunity available for the 2025-2026 school year. Compensation varies and depends on your teaching project, ranging from $400 to $1,200 weekly. Daytime teaching availability is required. No night or weekend classes! Kreyco ensures that all of our teachers have everything they need to be successful in their classrooms. This includes providing a comprehensive curriculum to our teachers, connecting them to supervisors and mentors in our network, and offering numerous professional development opportunities completely free of charge. Kreyco always has our teachers' backs! Our team is constantly growing as more and more schools reach out, hoping to offer language instruction to their students. As our network of schools expands nationwide, so does our network of teachers. We are always seeking qualified teachers to join our team. Kreyco teachers are qualified, passionate, and dedicated educators. Our teachers may come from diverse backgrounds, with work experience in a wide range of careers, but all share a common goal: they believe in the positive impact that learning a second language can have on our students. If this belief resonates with you, Kreyco may be your new professional home. Job Summary: • Job Location: On-site, • Schedule: M-F, daytime teaching hours, • Employment Type: Independent contractor You can learn more about Kreyco and what it is like to work with us by following this link to watch a short video: We look forward to hearing from you soon! Requirements • Bachelor's degree, • Authorized to work in the United States, • Ability to commute, • Professional development

Job DescriptionSalary: Join the Young Scholars Charter School team and help us Imagine New Possibilities in education. We have reimagined our schedule to be more sustainable for teachers and better for students. The upcoming 25-26 school year is exciting year for YSCS because we will start serving students in 5th grade and become a full 5-8 school! What makes YSCS a great place to work? • ALL teachers have a roster of 85 - 100 students and an average class size of 25 students. Why? We want you to build stronger and more meaningful relationships with your students., • ALL teachers are responsible for one grade and one content. Why? We want you to be experts in the classes you teach., • ALL teachers have between 120 minutes of prep time daily and common planning time with content teams. Why? We know that collaboration for teachers is important and prep periods during the day make the job more sustainable., • ALL staff members have the opportunity to influence the overall direction of the school. Why? We know that to have a wonderful work environment, you are critical in the decision-making process at the school. This years reimagined and more sustainable calendar and schedule were developed by teachers for teachers! Who are we? Young Scholars Charter School (YSCS) is a free, lottery-based, open-enrollment charter school serving students from across Philadelphia in grades 5-8. The mission of Young Scholars is to provide a personalized middle school education that challenges, engages and prepares all students to passionately pursue their dreams and lead a life of active citizenship. We aim to inspire and equip every student to lead a life of achievement, service and success. Our structured and nurturing community, comprehensive programming and rigorous academic curriculum are designed to build self-motivated citizens, eager learners and strong leaders regardless of circumstance. Our graduates are driven young people who are prepared for the future demands of high school, college, career and, eventually, the world. We seek to provide project-based learning and high-quality instruction to help students grow as learners and citizens. We believe in rigorous and culturally relevant curriculum where all students are given an opportunity to reach high academic success. Our teachers engage in extensive planning, strong instructional execution, and common skill-based assessments. Our curriculum engages students in building their academic proficiency and social-emotional skills to be successful. Who are we looking for? We are currently looking for a passionate hardworking Middle School Math Teacher to join the YSCS team and work with us to Imagine New Possibilities in Education. The teacher in this role will be working with 8th grade students. YSCS is a unique and innovative educational environment with a dual homeroom partner structure, regular coaching by an instructional leader, and extensive elective and sports offerings. All staff members are considered a critical player in decision making processes and have the opportunity to influence the overall direction of the school. Responsibilities • Plan and provide excellent instruction, making every minute count in your classroom;, • Develop detailed lesson plans, materials, homework assignments, and assessments based on state standards and school-wide goals for student achievement;, • Punctual to work;, • Submits lesson plans on time;, • Provide differentiated learning opportunities to support each students academic growth;, • Set and reinforce clear expectations for student engagement;, • Continuously improve based on feedback and coaching from school leaders;, • Collaborate with other teachers to increase student engagement and achievement;, • Reward positive student engagement and hold students accountable using school-wide systems;, • Engage with family members regularly and participate in school-wide family engagement activities including phone calls to family members and school-based meetings with families;, • Willing to perform other duties as assigned. Qualifications and Skills • Outstanding instructional skills and data-driven approach to instructional planning;, • Mastery and enthusiasm for content/subject area;, • The ability to motivate students and cultivate a culture of achievement;, • A belief that ALL students should be held to high academic standards;, • Resilience and professionalism;, • Commitment to school transformation and continuous improvement;, • Open to feedback and coaching;, • Strong sense of personal accountability for student achievement;, • Collaborative approach to problem solving. Educational Background and Work Experience • Experience driving student achievement results;, • Bachelors degree in Education or a related field;, • Must hold or be actively working to obtain PA teacher certification within the first year of employment, and completed by the second year. The Rewards • Competitive salary and benefits package;, • 3-4 prep periods a day;, • Professional collaboration with grade and content teams;, • Weekly coaching and ongoing professional development;, • 1:1 Chromebooks in every classroom;, • Google Education platform for online assignment management;, • The opportunity to maximize your impact in schools where we are raising the bar for student achievement.

Job Description About Us At Finance of America, we help homeowners unlock the joy that comes from realizing the full potential of their retirement. Many people have significant wealth tied up in their homes and want to use it meaningfully in their next chapter. Our unique range of reverse mortgages allow homeowners 55+ to access that wealth while maintaining control over their home and financial future. With options tailored to their unique goals, we provide the financial flexibility they need to move forward with confidence. Finance of America is guided by five values: We are customer obsessed, they are why we exist. We raise the bar. We take extreme ownership. We practice genuine collaboration. And we unleash our excellence. Together we are actualizing our vision to be the most beloved brand for homeowners in their next chapter. To learn more about us, visit Purpose of Role Responsible for establishing and implementing SRE best practices across our cloud-native infrastructure and DevOps CI/CD pipeline to improve the resilience, performance, and scalability of our systems while driving operational excellence and enhancing incident response capabilities. Works closely with Engineering, DevOps, Security, and Compliance teams to develop robust monitoring, alerting, automation, and risk mitigation strategies using a modern toolset spanning AWS, Datadog, JSM (Jira Service Management), Bitbucket, GitHub, and more. Key Responsibilities and Expectations • Establishes and enhances monitoring processes to ensure high system reliability and availability., • Designs and implements end-to-end observability metrics, logs, and traces using Datadog, New Relic, Elastic Search, and native AWS tools., • Develops dashboards and SLO/SLI metrics to monitor system health, application performance, and infrastructure availability., • Identifies and resolves reliability and availability gaps through proactive monitoring and data-driven analysis. Develops and streamlines incident response strategies, including efficient root cause analysis to minimize downtime and prevent recurrence., • Enhances and streamlines incident response workflows leveraging Jira Service Management (JSM)., • Establishes actionable runbooks and lead post-incident reviews to uncover systemic issues and track remediation., • Implements effective alerting strategies to reduce noise and response time., • Implements automation processes and scalability practices to improve system efficiency and agility., • Architects and implements automation for infrastructure management, CI/CD pipelines, and repetitive operational tasks., • Supports evaluation and onboarding of DevOps tools to optimize CI/CD processes., • Improves system scalability through efficient provisioning, deployment, and orchestration tools (Octopus Deploy, TeamCity, Pantheon)., • Enhances system observability through comprehensive metrics collection and analysis to proactively address potential issues., • Ensures systems adhere to compliance requirements and actively manage risks to maintain business continuity., • Assesses and implements new technologies and processes to establish best practices in site reliability engineering., • Defines and rolls out SRE practices, including reliability, and error budgets., • Develops and maintains reliability scorecards, operational health reports, and executive dashboards., • Collaborates with security and compliance teams to ensure systems meet governance, risk, and regulatory requirements., • Integrates monitoring and alerting tools with JSM workflows by closely working with JSM development team, for automated ticketing and escalation paths., • Works with version control and code repositories (Bitbucket, GitHub, Azure DevOps) to track reliability across builds and releases., • Recommends new tools and methodologies to enhance system resilience, performance, and traceability., • Minimum 10 years in Site Reliability Engineering, DevOps, or Infrastructure Engineering roles., • Hands-on experience with the following tools and technologies, or similar SRE tools experience: Observability: Datadog, New Relic, Elasticsearch, AWS CloudWatch; Incident Management: JIRA Service Management, ITSM practices; CI/CD Tools: TeamCity, Octopus Deploy, Bitbucket, GitHub, Azure DevOps; Infrastructure: AWS (EC2, S3, Lambda, ECS, IAM, CloudFormation or Terraform)., • Strong programming/scripting ability in one or more: Python, Bash, PowerShell, Go., • Experience building dashboards, KPIs, and reports for engineering and executive audiences., • Excellent knowledge of SRE frameworks, including SLOs, SLIs, MTTR, error budgets, and fault tolerance., • Strong interpersonal, verbal and written communication, and organizational skills., • Flexibility to adjust to multiple demands, shifting priorities, and rapid change., • Flexibility in scheduling with a willingness to work extra non-standard hours on occasion., • Familiarity with compliance frameworks (SOC 2, ISO 27001, etc.) preferred., • Experience working in environments where the operations and infrastructure behind websites (WebOps) are managed alongside content management platforms (e.g., Pantheon) and a strong focus is placed on site speed, reliability, and user experience preferred., • Computer Science or related technical field. The base salary range for this position is ($140,000 - $175,000) inclusive of all geographical differences in the labor market. The base salary for the position will be determined based on factors such as the candidate’s work location, skills, education, and experience. In addition to those factors, we believe in the importance of pay equity and consider the internal equity of our current team members in determining any final offer. We offer a competitive benefits package including health, dental, vision, life insurance, paid time-off benefits, flexible spending account, 401(k) with employer match, and ESPP. Additional Information The application deadline for this job opportunity is 10/13/2025. The above statements are intended to describe the general nature and level of work being performed by people assigned to this classification. They are not to be construed as an exhaustive list of all responsibilities, duties, and skills required of personnel so classified. Finance of America is an Equal Opportunity Employer. All qualified applicants will receive consideration for employment without regard to race, color, sex (including pregnancy), sexual orientation, religion, creed, age, national origin, physical or mental disability, gender identity and/or expression, marital status, veteran status or other characteristics protected by law.

Job Description Embark on a transformative journey at the forefront of innovation as a Generative AI Strategist. Are you ready to shape the future of business by unleashing the power of generative AI and machine learning? Join us in driving strategic alignment, fostering collaborative engagement, and leading sales initiatives to deliver tangible business value through cutting-edge generative AI solutions. If you possess a passion for innovation and a drive to revolutionize businesses through generative AI, we welcome you to be part of our dynamic team. Seize this opportunity to drive impactful change and lead businesses into a new era of technological advancement as a Generative AI Strategist. Key Responsibilities: Strategic Alignment: • Facilitate alignment between the customer's technologists and business leaders to unleash the potential of generative AI and machine learning for driving business value., • Work closely with various teams within the customer's organization, including applied scientists, solutions architects, business development, marketing, and industry specialists to foster collaboration and innovation., • Lead the strategic direction of large, complex sales opportunities from inception to successful closure and delivery., • Conduct interactive workshop sessions with customers to identify potential areas for deploying generative AI and machine learning solutions., • Proven experience in strategizing and implementing generative AI solutions in a business context., • Strong communication skills to engage with stakeholders at all levels and effectively convey complex concepts., • Expertise in collaborating with cross-functional teams and external partners to drive innovation and business growth., • Demonstrated ability to lead sales processes for complex technological solutions.

Job Description Kreyco (formerly known as LLN) is a nationwide organization that specializes in PK-12 world language education. We support language learners of all kinds by connecting schools nationwide to teachers for Spanish, French, Italian, German, Mandarin, Japanese, Arabic, American Sign Language (ASL), and more. Our schools and students are our driving force, and as we seek to meet their needs, we are searching for language teachers of all sorts. We are beginning our search for on-site K-12 Spanish teaching opportunities for the 2025-2026 school year. If you are interested, please apply, and we will be in touch should an opportunity arise in your area. Compensation varies and depends on your teaching project, ranging from $400 to $1,200 weekly. Daytime teaching availability is required. No night or weekend classes! Kreyco ensures that all of our teachers have everything they need to be successful in their classrooms. This includes providing a comprehensive curriculum to our teachers, connecting them to supervisors and mentors in our network, and offering numerous professional development opportunities completely free of charge. Kreyco always has our teachers' backs! Our team is constantly growing as more and more schools reach out, hoping to offer language instruction to their students. As our network of schools expands nationwide, so does our network of teachers. We are always seeking qualified teachers to join our team. Kreyco teachers are qualified, passionate, and dedicated educators. Our teachers may come from diverse backgrounds, with work experience in a wide range of careers, but all share a common goal: they believe in the positive impact that learning a second language can have on our students. If this belief resonates with you, Kreyco may be your new professional home. Job Summary: • Job Location: On-site, • Schedule: M-F, daytime teaching hours, • Employment Type: Independent contractor You can learn more about Kreyco and what it is like to work with us by following this link to watch a short video: Kreyco is hiring! We look forward to hearing from you soon! Requirements • Bachelor's degree, • Authorized to work in the United States, • Ability to commute, • Professional development

Job DescriptionDescription: Job Title: Behavioral Health Technician (BHT) Department: Operations Reports to: Director of Operations/BHT Supervisor Job Summary: The Behavioral Health Technician is responsible for assisting and supporting the Facility Director and all treatment program staff, in coordinating and providing the day to day operational needs of the facility and its patients'. BHT’s are responsible for assisting with scheduled monitoring and reporting of the condition of the facility to ensure safe and orderly operations. The BHT is involved with certain intake procedures, including but not limited to obtaining data when a patient arrives to the facility, conducting searches and rounds, ensuring the safety of a patient during their treatment stay, and assisting the treatment teams with the overseeing of patients’ throughout their daily schedules within the facilities policies and procedures and in accordance with the standards of the State and Federal Regulations. Depending on an individual's safe driving record, some BHT’s may be involved with transportation and complying with vehicle and road/patient safety measures. Duties/Responsibilities: • Assist with the supervision of patients' in their daily activities., • Ensure that the patient’s follow the clinical schedule, and communicates any issues to the treatment team., • Transport clients (when applicable) as needed (Must have valid Driver's license) If it is part of your duties and you are eligible to drive you must:, • Obey the rules of the department of motor vehicles, department of transportation, and all safety regulations put forth by the State., • Conduct vehicle and client safety checklists before transporting clients or utilizing the vehicle., • Transport client afternoon medications in a locked and secure manner., • Make continuous rounds of the facility, rooms, and grounds, to ensure overall safety., • Observe and document all medications taken by clients during scheduled medication times., • Seeks out contraband, and reports any suspicions or findings immediately to their supervisor., • Proactive in ensuring that the rules of the facility and the rights of the patient are being upheld., • Communicate and/or resolves issues with housekeeping duties, and upkeep of buildings and grounds., • Assist with readying rooms and common areas for client admission and discharges., • Fosters a supportive environment for clients that follows ethical treatment., • Seeks corrective criticism and has the ability to evaluate suggestions objectively., • Reports to work per their assigned schedule & maintains acceptable overall attendance., • Promotes a favorable/positive work atmosphere that is based on a team mentality., • Completes all required trainings, and attends in-services and educational training as necessary and as assigned., • Maintains flexibility and adaptability to expected and unexpected changes in the work environment., • Reports (personal/within the facility) suspected illnesses of contagious diseases to Facility Director., • Maintains safety of the physical environment., • Communicates all grievances, incidents, reports suspected Abuse, Neglect, Trauma, or Exploitation, safety issues or breaches to Supervisor., • Independently solve problems and follow through., • Functions independently in an treatment program environment., • Plerform other tasks and duties as assigned., • Staff who assess individuals with substance abuse, dependence, and other addictive behaviors and who plan services for and deliver services to these individuals have the knowledge and skills to do the following: • Establish rapport, systematically gather data, determine the readiness of the individual for treatment and change, and apply accepted criteria for diagnosis of substance use disorders, • Screen for psychoactive substance toxicity, intoxication, and withdrawal symptoms, • Screen for danger to self or others(If applicable), • Screen for co-occurring mental health issues, • Analyze and interpret data to determine treatment recommendations and priorities, • With the individual served, formulate mutually agreed-upon, measurable treatment goals and objectives, • Demonstrate adherence to accepted ethical and behavioral standards of conduct, • Participate in continuing professional development Note: This does not mean that every staff member must have all of these competencies; rather the total complement of staff together possess all of these competencies. Requirements: Required Skills/Abilities: Required to maintain up to date certification • CPR, Verbal De-Escalation, HIPAA, HIV/AIDS, Incident Reporting, Infection Control, Overdose Prevention, and Self-Administration of Medications (when applicable),, • Completes CLIA waived training and follows the guidelines and steps for conducting and collecting samples for tests such as the Urine Drug Screening, a Breathalyzer, a Glucometer, and Pregnancy tests when applicable., • Ability to work as a team member and have communication, organizational and interpersonal skills, • Ability to work under stressful conditions and be flexible in relation to department needs, • Knowledge of TJC standards within the Department, • Demonstrates Proficiency in Verbal and written Communication Skills, • Knowledge of State and Federal Statutes Regarding Patient Confidentiality Laws, • Ability to understand and abide by the Drug Free Workplace Policies, • Ability to complete the Harassment and Discrimination training, • Knowledge of Corporate Integrity and Compliance Program, • Knowledge of current technology, • Knowledge of Substance Use Disorder. Can score above a 70% on the SUD Training, • High School Diploma, GED, or equivalent work experience in customer service, hospital, or treatment program setting., • A minimum of five years driving experience and a Valid driver’s license and clear driving record approved by insurance carrier. (For drivers), • Experience in the field of chemical dependency/substance abuse/psychiatric setting or human services field is preferred., • Complete TB testing upon being hired, • Undergo a Background consent and results prior to hire The physical demands described here are representative of those that must be met by an employee to successfully perform the essential functions of this job. Reasonable accommodations may be made to enable individuals with disabilities to perform the essential functions. The employee must frequently lift and/or move up to 10 pounds and occasionally lift and/or move up to 25 pounds. While performing the duties of this job, the employee is regularly required to talk or hear. The employee is frequently required to stand; walk and sit. The employee is occasionally required to use hands to finger, handle, or feel; reach with hands and arms; climb or balance and stoop, kneel, crouch, or crawl. Working Conditions and Environment: • The work environment characteristics described here are representative of those an employee encounters while performing the essential functions of this job. Reasonable accommodations may be made to enable individuals with disabilities to perform the essential functions., • The noise level in the work environment is usually moderate. Position is required to work in indoor and outdoor environments as needed. Potential exposure to violent situations. No potential exposure to airborne/blood-borne pathogens and other potentially infectious materials.

Job DescriptionAbout the Job: Are you passionate about helping clients discover their own sense of recovery? Have you been looking for an opportunity to create impact? At Epiphany Wellness, our mission is true transformation by leading the way we reinvent & treat addiction. Our company is dedicated to providing the highest level of care using known and proven methods for our client's success. We strive to meet our main goal to help everyone live a happy and healthy life without substance abuse issues, addiction, or mental health concerns. We are looking for a Recovery Behavioral Health Technician who will work closely with clients to determine their rehabilitation needs and to provide individualized treatment by providing structured as well as holistic healing. Supports clients with foundational well-being that develops the skills needed to overcome, heal & grow to sustain long-term sobriety. The Recovery Behavioral Health Technician acts as a representative of Epiphany Wellness. BHT’s observe all client activity and maintain visible presence of the clients at all times. BHT’s maintain excellent reporting skills on client whereabouts, any and all issues that arise and basic needs while on shift. BHT’s are responsible for making sure clients are attending their clinical hours and getting the help they need to obtain long-term sobriety. Hourly Rate: * Up to $20/ per hour Schedule: * OPEN 1st, 2nd & Overnight shifts available * FLEXIBLE Swing shift - 1pm to 9:30pm What will your day look like? You will: * Client safety is Epiphany’s top priority. BHT’s performs this by maintaining a safe therapeutic environment for clients at all times. * Maintain daily/weekly structure and schedule for clients as outlined in client schedule. * Observation of client medication that is considered a controlled substance * Ensure clients are filling out self-observation sheets for medication. * Completing rounds at the beginning, throughout, and at the end of shift. When clients are placed on Q30 rounds, completing them accordingly with appropriate documentation * Overnight is responsible for hourly rounds unless otherwise specified for high-risk clients; all rounds documented in BHT chat * Transporting clients to and from appointments, clinical services, employment if applicable, and other outside activities. Ensuring Epiphany’s driving policy is being followed, and if an accident occurs, accident policy is followed * Performing Urinalysis as assigned, reading urinalysis results on a 12-panel and reporting and recording appropriate documentation as well as communicating to appropriate supervisor. * Performing breathalyzers on clients as assigned. Reporting any results over 0.00 to on call supervisor * Reporting and completing shift notes for each shift * Following chain of command at all times. Being aware of when and how to report any issues on shift, including but not limited to facilities, clients, and other staff * Building positive relationships with clients and staff * Utilizing BHT chat when on shift for communication with other staff and supervisor * Flexibility - BHT scheduling (coverage can be needed at any time). Client schedule changes, last-minute intakes, behavioral issues etc. * Searching client belongings upon intake, vehicles, and rooms as assigned by BHT Supervisor * Reporting Suicidal Ideation and Homicidal Ideations of any patients * Completing client intakes, following all steps as outlined intake protocol * Crisis intervention included, but not limited to, client altercation (verbal or physical), relapse, behavioral issues * AMA blocking as needed * Facilitating client rules and responsibilities, and reporting non-compliance to supervisor What you will need for this position: * Minimum of one (1) year in the Recovery/Substance Abuse field (preferred). * Working knowledge of 12-Step Program, AA or NA preferred. * High School Diploma or GED. * Behavioral Health Technician Certification, preferred. * Certified Peer Recovery Specialist CPRS, preferred * CPR Certified, preferred. * Standard First Aid Certification, preferred. * Valid Driver's License, with minimum 2 years CLEAN driving record; (required). Who we are: Epiphany Wellness is a state-of-the-art alcohol & drug addiction rehab and mental health rehab center. Our expert, evidence-based program offers treatment for substance abuse disorder and those with mental health issues. Our program is personalized based on the needs of each individual, and our clinical team creates custom-tailored recovery plans for each patient. Start your journey to support lasting recovery today! Here at Epiphany Wellness, we foster an environment that encourages our team members to grow and develop their careers organically. What we offer: * Competitive Salary * Flexible Schedule * Comprehensive benefits package includes life, medical, dental, and vision * Tuition Reimbursement * Vacation and Flex benefits * Paid Holidays * A company culture of promotions from within, with a start-up atmosphere allowing for varied and rapid career development. Epiphany Wellness is an equal opportunity employer. We celebrate diversity and are committed to creating an inclusive environment for all employees. We prohibit discrimination and harassment of any kind based on race, color, sex, religion, sexual orientation, national origin, disability, genetic information, pregnancy, or any other protected characteristic as outlined by federal, state, or local laws. This policy applies to all employment practices within our organization, including hiring, recruiting, promotion, termination, layoff, recall, leave of absence, compensation, benefits, training, and apprenticeship. Epiphany Wellness makes hiring decisions based solely on qualifications, merit, and business needs at the time.

Job Description Join Our Team! We're Hiring a Car Salesperson at Rafferty Subaru Are you passionate about cars? Do you enjoy helping people find their perfect ride? We're looking for an enthusiastic, driven, and customer-focused individual to join our sales team at Rafferty Subaru! Why Join Us? • Competitive Pay & Bonuses: We offer a competitive salary with opportunities for bonuses and commissions based on performance., • Great Benefits: Health insurance, 401(k) options, paid time off, and more!, • Fun Work Environment: Join a friendly and supportive team dedicated to helping customers make informed decisions., • Strong communication and interpersonal skills, • A passion for Subaru vehicles and the automotive industry, • A desire to provide exceptional customer service, • Previous sales experience (preferred, but not required), • High school diploma or equivalent; degree in business or marketing preferred., • Ability to work flexible hours, including evenings and weekends., • Assist customers in selecting the right vehicle for their needs, • Provide product knowledge and a high level of customer service, • Handle all aspects of the sales process, from greeting the customer to finalizing the sale Apply Today at or Bob Rafferty at 610-353-6900 ext 124 We can’t wait to meet you and start driving success together! Rafferty Subaru – Where Passion Meets the Road EEOC Statement: Rafferty Subaru is an equal opportunity employer and values diversity at our company. We do not discriminate on the basis of race, religion, color, national origin, gender, sexual orientation, age, marital status, veteran status, or disability status. We are committed to creating an inclusive and welcoming environment for all employees.

Job Description We are currently seeking a LPN or RN to join our In Home and Community Supports program as a part-time Nurse with Direct Support Professional Duties. We have a case available to work 1:1 with an individual with intellectual disabilities in need of nursing and direct support in Norristown, PA! This role is in a very lively family’s home setting. You will have the opportunity to provide both nursing care and personal supports to adults with developmental disabilities/Autism who desire to continue living in a home environment for as long as possible. Your daily actions will enable each individual to flourish in their desired home context, maintain or increase their independence, and live their best lives. Your goal is to provide the highest quality care for each individual. Work Schedule: 10 hours per week split over 2-3 weekdays, based on your availability. Shifts end by 3PM. Key Responsibilities: • Work closely with program leaders to provide quality nursing care to individual being served in the program., • Provide direct support in the home and community. This consists of..., • In the individual’s home: cooking, cleaning and personal care, • In the community: activities with the individual such as going to an event at the library, attending a yoga class, shopping for groceries for the week, and supporting whatever goals and dreams the individual has!, • Work in conjunction with agency staff and client team members to develop a plan of care that addresses an individual’s medical, physical, and emotional needs., • Provide comprehensive healthcare consultation to teams., • Participate in team meetings as needed and directed., • As needed, conduct training for staff around healthcare issues. Candidates must meet all qualifying and ongoing job criteria including background checks, DMV history, physical examination results, and clearances. Driving Requirements: • A valid driver's license, and access to a reliable vehicle during work hours., • A U.S. driver’s license for at least two years (not including time with a permit)., • Must be listed as a driver on a valid auto insurance policy. Education: Successful completion of a state approved Registered Nursing or Licensed Practical Nursing program. Certification: Current PA licensure. Experience: Two (2) or more years of professional nursing experience required, preferably working with individuals with intellectual disabilities and autism diagnoses. Knowledge, Skills, and Abilities: • Critical thinking skills., • Appropriate sense of urgency when required of situations., • Excellent organizational and written/oral communication skills., • Ability to effectively interact with all levels of staff., • Ability to handle multiple priorities., • Ability to effectively interact as part of a team., • Knowledge of managed care principles as they pertain to obtaining healthcare., • Proficiency in, or ability to learn and use, workplace applications, platforms and technologies, including our electronic health record system for documentation., • Ability to navigate network drives and basic hardware use and troubleshooting. Benefits Compensation and schedule: • The hourly rate starts at $26/hour, with increases based on education and experience., • This is a part-time position of 10 hours/week over 2-3 days/weekdays with shifts ending by 3PM., • This position is located at an individual’s home in Norristown, PA and the shift will be worked both in the home and out in the community. All employees receive the following benefits: • Mileage Reimbursement, paid travel time between worksites, • Employee Assistance Program (EAP), • Referral Bonuses, • Ongoing Training, • Discounts on various services, perks with local Credit Unions, college tuition discounts Essential Working Conditions/Physical Demands: Work in program sites and the community routinely providing direct care and support with individual(s). Stand, sit or run by self, or to provide proper care and supervision with an individual. Able to move and stay with an individual to keep them safe, both in home environment and community, both at near and far distances, even when an individual may struggle to meet identified expectations. Able to assist an individual who has fallen, regardless of weight or size. Walk, climb stairs by self, or to provide direct care ensuring individual’s safety, or to complete household and community tasks. Perform household tasks or tasks within the community such as laundry, cleaning, completing meal routines, shopping or dining out and, at the same time, ensuring the individual’s safety and proper direct care and compliance with ISP. Access Services is an equal opportunity employer.