Trabajos health safety en Mitcham - Page 2Crear alertas

We believe in giving you more time to do the things you love outside of work Job Title: SEN Teacher - KS3/4 Location: Baston House School, Bromley, Kent, BR2 7AB Hours: 37.5 per week | Monday–Friday | 8.30am - 4.30pm Salary: £39,000 - £50,500 per annum (depending on experience, not pro rata) Contract: Permanent | Term Time Only Start: September 2026 UK applicants only – no sponsorship available About the Role Are you ready to inspire, empower, and make a real difference in the lives of students? We are looking for a dynamic and dedicated Teacher to join our thriving school community! As a key member of our team, you will deliver high-quality education, tailored to the needs of individual students and small groups, all within a supportive, innovative, and inspiring learning environment. What You’ll Do: • Teach and Inspire: Plan and deliver engaging lessons that spark curiosity and support each student’s growth., • Monitor Progress: Track, report, and celebrate student achievements while shaping the future of their learning journey., • Create a Positive Environment: Design classrooms, displays, and resources that make learning exciting and stimulating., • Develop Individual Plans: Craft and implement tailored education and behaviour plans to help every student thrive., • Collaborate and Lead: Work alongside a multi-professional team to ensure consistent, high-quality support across all aspects of school life., • Safeguard and Support: Prioritise student wellbeing and safety while fostering independence and self-control., • Stay Ahead: Keep up-to-date with the latest educational practices to ensure our students receive the best possible experience. What We’re Looking For: • QTS qualification or equivalent is required for this role, • Passion for making a difference in young lives, • Strong classroom management skills and ability to work with challenging behaviours, • Team player mindset, ready to collaborate and communicate effectively, • Commitment to student development – academically, socially, and morally About Us Baston House School is an independent day specialist school in Bromley, Kent, supporting children and young people aged 5–19 with Autism Spectrum Conditions (ASC) and associated needs. The school provides a safe, inclusive, and supportive environment where pupils are fully included in all aspects of school life. Our focus is on developing academic skills, social understanding, emotional wellbeing, and independence, enabling each pupil to achieve positive outcomes and prepare for their next steps. By fostering a strong sense of community and personalised learning, Baston House ensures every pupil is valued, supported, and empowered to reach their full potential. For over 19 years, Options Autism has provided specialist care and education for children, young people, and adults with autism, complex needs, and learning difficulties. As part of Outcomes First Group, we are pioneering innovative, evidence-based approaches that deliver meaningful, measurable outcomes for everyone in our care. We are really proud to say that in 2025 Outcomes First Group were officially certified as a ‘Great Place to Work’ for the sixth year running. Why Join Us? We place pupils and vulnerable young adults at the heart of everything we do, so every day brings the satisfaction of making a real difference. We are committed to the safeguarding and promoting the welfare of pupils and young people. All applicants will be subject to social media checks and successful applicants to a fully enhanced DBS. • Life Assurance, • Pension scheme with options to increase contributions, • “Your Wellbeing Matters” – mental health support and physical health checks, • Flexible Benefits Platform (Vista), including:, • Health, wellbeing and insurance benefits, • Hundreds of UK and international discounts, • Cycle to Work Scheme & Electric Car Purchase Scheme, • Critical illness cover, • Family Growth Support, including enhanced maternity/paternity leave and paid fertility treatment support We reserve the right to close the vacancy early if we receive a high volume of suitable applications. Outcomes First Group is committed to carrying out a fair, thorough and efficient recruitment process in line with Keeping Children Safe in Education. Whilst we aim to keep applicants informed throughout, Outcomes First Group does not accept liability for any loss of earnings or other associated costs incurred by applicants as a result of delays or changes in the compliance process. All stages of the compliance process are subject to necessary safeguarding checks and compliance with statutory requirements, which may affect timescales. #1

We believe in giving you more time to do the things you love outside of work Job Title: Autism Practitioner Location: Baston House School, Bromley, Kent, BR2 7AB Hours: 37.5 per week | Monday–Friday | 8.30am - 4.30pm Salary: £24,675.00 per annum (not pro rata) Contract: Permanent | Term Time Only Start: September 2026 UK applicants only – no sponsorship available About the Role As an Autism Practitioner, you will support students to access and engage with their learning in a safe, structured, and stimulating environment. Working closely with teachers, tutors, and the wider multi-professional team, you will provide tailored support that promotes independence, social development, and emotional wellbeing. You will also assist in planning, delivering, and adapting resources and interventions to meet individual needs. Key Responsibilities • Support teachers and tutors in delivering high-quality, inclusive education for students with autism, • Assist in the implementation of school policies, procedures, and individualised education plans, • Provide targeted one-to-one and small group support to enable students to access the curriculum with increasing independence, • Promote students’ physical, academic, social, and moral development, • Organise and maintain engaging classroom environments, including resources and displays, • Contribute to the preparation and upkeep of student documentation, such as Behaviour Support Plans (BSPs), Individual Education Plans (IEPs), Communication Profiles, Risk Assessments, and Pastoral Support Plans, • Work collaboratively with staff to ensure student safety both on and off-site, in line with risk assessments, • Contribute to the school’s ongoing development, improvement plans, and wider initiatives About You We’re looking for someone who: • GCSEs (or equivalent) in English and Maths at minimum Level 4 (Grade C), • Has experience working with pupils with autism and/or challenging behaviour, • Can work independently and as part of a team, • Has strong communication skills, both verbal and written, • Is adaptable, patient, and proactive, committed to helping pupils achieve their potential About Us Baston House School is an independent day specialist school in Bromley, Kent, supporting children and young people aged 5–19 with Autism Spectrum Conditions (ASC) and associated needs. The school provides a safe, inclusive, and supportive environment where pupils are fully included in all aspects of school life. Our focus is on developing academic skills, social understanding, emotional wellbeing, and independence, enabling each pupil to achieve positive outcomes and prepare for their next steps. By fostering a strong sense of community and personalised learning, Baston House ensures every pupil is valued, supported, and empowered to reach their full potential. For over 19 years, Options Autism has provided specialist care and education for children, young people, and adults with autism, complex needs, and learning difficulties. As part of Outcomes First Group, we are pioneering innovative, evidence-based approaches that deliver meaningful, measurable outcomes for everyone in our care. We are really proud to say that in 2025 Outcomes First Group were officially certified as a ‘Great Place to Work’ for the sixth year running. Why Join Us? We place pupils and vulnerable young adults at the heart of everything we do, so every day brings the satisfaction of making a real difference. We are committed to the safeguarding and promoting the welfare of pupils and young people. All applicants will be subject to social media checks and successful applicants to a fully enhanced DBS. • Life Assurance, • Pension scheme with options to increase contributions, • “Your Wellbeing Matters” – mental health support and physical health checks, • Flexible Benefits Platform (Vista), including:, • Health, wellbeing and insurance benefits, • Hundreds of UK and international discounts, • Cycle to Work Scheme & Electric Car Purchase Scheme, • Critical illness cover, • Family Growth Support, including enhanced maternity/paternity leave and paid fertility treatment support We reserve the right to close the vacancy early if we receive a high volume of suitable applications. Outcomes First Group is committed to carrying out a fair, thorough and efficient recruitment process in line with Keeping Children Safe in Education. Whilst we aim to keep applicants informed throughout, Outcomes First Group does not accept liability for any loss of earnings or other associated costs incurred by applicants as a result of delays or changes in the compliance process. All stages of the compliance process are subject to necessary safeguarding checks and compliance with statutory requirements, which may affect timescales. #1

We believe in giving you more time to do the things you love outside of work Job Title: Primary SEN Teacher Location: Baston House School, Bromley, Kent, BR2 7AB Hours: 37.5 per week | Monday–Friday | 8.30am - 4.30pm Salary: Up to £50,500 per annum (depending on experience, not pro rata) Contract: Permanent | Term Time Only Start: September 2026 UK applicants only – no sponsorship available About the Role Are you passionate about transforming the lives of children with special educational needs? We are seeking an enthusiastic and skilled Primary SEN Teacher to join our vibrant and supportive school community. In this rewarding role, you will deliver high‑quality, personalised teaching to primary-aged pupils with a range of SEN needs, helping them develop academically, socially, and emotionally. You’ll be part of a dedicated team committed to creating a nurturing, structured, and inspiring learning environment where every child can thrive. What You’ll Do: • Teach and Inspire: Plan and deliver engaging, differentiated lessons tailored to the needs of primary-aged pupils with SEN, fostering curiosity, confidence, and independence., • Support Individual Progress: Monitor, assess, and celebrate student achievements, ensuring each child’s learning journey is meaningful and well-supported., • Create a Positive Environment: Develop stimulating classroom spaces, displays, and resources that promote engagement and a love of learning., • Develop Personalised Plans: Create and implement individual education plans (IEPs) and behaviour support strategies that reflect each pupil’s unique needs., • Collaborate and Lead: Work closely with a multi-disciplinary team—including therapists, support staff, and senior leaders—to ensure consistent, high-quality provision., • Safeguard and Support: Prioritise pupil wellbeing, safety, and emotional development while promoting self-regulation and positive behaviour., • Stay Ahead: Engage in ongoing professional development to ensure your practice reflects the latest SEN and primary education approaches. What We’re Looking For: • QTS or equivalent required, • Experience or strong interest in working with primary-aged pupils with SEN, • A nurturing, patient, and resilient approach, • Strong classroom management skills, including supporting pupils with challenging behaviours, • A collaborative mindset and excellent communication skills, • Commitment to helping every child reach their full potential—academically, socially, and emotionally About Us Baston House School is an independent day specialist school in Bromley, Kent, supporting children and young people aged 5–19 with Autism Spectrum Conditions (ASC) and associated needs. The school provides a safe, inclusive, and supportive environment where pupils are fully included in all aspects of school life. Our focus is on developing academic skills, social understanding, emotional wellbeing, and independence, enabling each pupil to achieve positive outcomes and prepare for their next steps. By fostering a strong sense of community and personalised learning, Baston House ensures every pupil is valued, supported, and empowered to reach their full potential. For over 19 years, Options Autism has provided specialist care and education for children, young people, and adults with autism, complex needs, and learning difficulties. As part of Outcomes First Group, we are pioneering innovative, evidence-based approaches that deliver meaningful, measurable outcomes for everyone in our care. We are really proud to say that in 2025 Outcomes First Group were officially certified as a ‘Great Place to Work’ for the sixth year running. Why Join Us? We place pupils and vulnerable young adults at the heart of everything we do, so every day brings the satisfaction of making a real difference. We are committed to the safeguarding and promoting the welfare of pupils and young people. All applicants will be subject to social media checks and successful applicants to a fully enhanced DBS. • Life Assurance, • Pension scheme with options to increase contributions, • “Your Wellbeing Matters” – mental health support and physical health checks, • Flexible Benefits Platform (Vista), including:, • Health, wellbeing and insurance benefits, • Hundreds of UK and international discounts, • Cycle to Work Scheme & Electric Car Purchase Scheme, • Critical illness cover, • Family Growth Support, including enhanced maternity/paternity leave and paid fertility treatment support We reserve the right to close the vacancy early if we receive a high volume of suitable applications. Outcomes First Group is committed to carrying out a fair, thorough and efficient recruitment process in line with Keeping Children Safe in Education. Whilst we aim to keep applicants informed throughout, Outcomes First Group does not accept liability for any loss of earnings or other associated costs incurred by applicants as a result of delays or changes in the compliance process. All stages of the compliance process are subject to necessary safeguarding checks and compliance with statutory requirements, which may affect timescales. #1

Step Into Education That Truly Changes Lives Location: Cumnor House Schools Job Title: Maintenance Operative (Caretaker) Contract: Permanent - Full-Time Hours: 40 hours per week Salary: £28,650.00 Per Annum Start Date: ASAP About Cumnor House Here at Cumnor House , we are dedicated to giving our children the perfect platform to achieve their potential. Our philosophy is to ensure that each pupil at Cumnor House is given the opportunity to develop not just on an educational level, but also socially. Therefore, our curriculum contains varied subjects and activities, ensuring that every child gets the most out of the time they spend at school. By striking the perfect balance between disciplined learning practices and a friendly atmosphere we can be confident in providing the perfect environment for our children to flourish. Role Purpose A Maintenance Operative is required to assist in the provision of a day-to-day maintenance function, to ensure the smooth running of the Cumnor House Schools' operations. Ensuring the school buildings and grounds are kept clean, safe and secure, in accordance with the operational needs of the school and any regulatory requirements. What you will be doing Key Responsibilities • To ensure that the maintenance of the school building and grounds is undertaken and provide the necessary information of completion to the Facilities Manager., • General minor repair work including doors, windows, toilet seats and flushes, furniture, tap washers and some painting of doors and walls. Appropriate refurbishment, painting and redecoration. (This list is not exhaustive, but an example) • To ensure that all emergency, security and safety systems and equipment (fire extinguishers, fire alarms, intruder alarms, surveillance systems, tools etc.) are monitored, maintained and tested as appropriate. • To follow procedures set out for the safety and security of the school premises including retrieving CCTV footage as requested., • To ensure the necessary records of the school building, grounds and equipment are kept in relation to Health and Safety (H&S) and statutory inspection and maintenance guidelines. • To have a good working knowledge of relevant current legislation and good practice, reporting any concerns to the Facilities Manager., • To be conscious of and comply with H&S legislation whilst discharging of duties and responsibilities. To report any concerns to the Facilities Manager., • To be aware of your responsibilities with regard to any critical incident and follow instructions given by the Senior Leadership Team at such a time., • To report any concerns that require specialist expertise and/or resources to the Business Manager., • Carry out portaging duties and assist with the removal and fitting of office and classroom furniture as directed by the Facilities Manager, • Swimming Pool: Testing & adjusting chemical properties, remove debris and keeping pool area clean o What you'll bring Qualifications, Skills and Experience Essential • Full UK Driving License - A full UK driving license is mandatory, as the post holder may be required to provide cover for shuttle runs between sites and home-to-school transport on an ad hoc basis to support staff absences and operational needs, • Building trade experience e.g. plumbing, electrics, decorating, • A practical hands-on approach, • Must possess good communication skills, • Must be able to demonstrate a knowledge of building trade skills and/or ground maintenance, • Ability to work as part of a team and on your own initiative, • Ability to work with enthusiasm and motivation without direct supervision or when part of a team, • To learn new skills, techniques and practices for various trades, health and safety and grounds maintenance, • Effective time management, • Ability to work under pressure Desirable • IWFM Level 2, • IOSH Level 2, • First Aid at Work, • Fire Marshall, • Health and safety certification, • Experience working in an educational environment, • Professionalism in your approach to work and tasks set Cumnor House School is committed to safeguarding and promoting the welfare of children and young people. All appointments are subject to enhanced DBS and safeguarding checks. Early applications are encouraged as we reserve the right to appoint prior to the closing date.

We burst onto the restaurant scene in 1997, when we shook up London and showed the UK a new way of eating. Part of this was the 'kaiten' conveyor belt and colour-coded dishes which made our name. We're all about fresh, flavoursome, authentic Japanese food. Sushi is what we're famous for, but we also have a mouth-watering range of hot street food available - from traditional classics to innovative fusion dishes. All packed with rich, aromatic flavours and umami. Fast forward to today and we have over 70 restaurants all over the globe, more than 300 kiosks in the UK, with grocery products and pre-pack sushi in most major UK supermarkets. We’re looking for an inspiring, hands on Head Chef who loves great food, thrives in a high energy environment, and knows how to bring out the best in a kitchen team. If you’re passionate about quality, consistency, and leading from the front—this could be your next move About You – A Leader with Food at the Heart You’re calm under pressure, confident in your craft, and passionate about creating great food while building a strong, positive kitchen culture. You are: • Passionate about food, especially sushi and Japanese inspired dishes, • An experienced kitchen leader who leads by example, • Detail driven, with high standards for quality and consistency, • Calm, organised, and confident during busy services, • Hands on and happy to be on the pass and on the floor, • A people focused leader who enjoys developing and motivating others, • Keen to grow, improve, and keep the kitchen moving forward, • Commercially aware, with experience managing stock, food costs, labour, and kitchen budgets Key Responsibilities As Head Chef, you’ll take full ownership of the kitchen—leading the team, delivering great food every time, and creating an environment where people feel supported and proud of what they do. You’ll be: • Leading, motivating, and developing the kitchen team, • Ensuring every dish is fresh, consistent, and beautifully presented, • Managing service with calm leadership and clear communication, • Working closely with the General Manager to deliver a great overall experience, • Training and developing your team to build strong future talent, • Maintaining high standards across food quality, safety, and cleanliness, • Managing stock, deliveries, and kitchen organisation, • Creating a positive, inclusive, high energy kitchen culture, • Driving consistency, structure, and continuous improvement We're proud to offer: • Fantastic working hours, • Free YO! food - What's your favourite YO! dish? Every time you work you can power your shift with a selection of your choice from our fantastic menu, • Grow with YO!- we will pay for you to achieve professional qualifications (up to Degree level) whilst you work, • Brilliant support services designed to enhance your physical, mental and financial wellbeing including private medical health plan and 24/7 Employee Assistance Line, • Discounted gym membership, cinema tickets, dining out and retail offers <

Were on the hunt for a proactive Automation Service Engineer to join our fast-growing team! Youll work across social housing and commercial contracts, tackling everything from reactive callouts to planned maintenance and installations on automatic doors, gates, and barriers.Salary: £48,000Location: Field based. South London.Hours : 40 hours per week. Monday- Friday 8:30- 17:00Additional Information : This role is for permanent employment, please do not apply if only looking for subcontractor work. Vehicle provided! Must have a UK manual full driving license.What You'll Be Doing:Responding to urgent call-outs and fixing faults fastCarrying out installs, servicing & maintenanceSurveying and inspecting automated systemsLogging jobs with clear, detailed infoFollowing strict health & safety standardsKeeping timesheets up to dateBeing flexible overtime and on-call rota availableWhat You'll Bring:ADSA or ADIA accredited3+ years working with automatic doors & gatesFull UK Driving LicensePositive, flexible, and customer-first mindsetGreat communicator with strong attention to detailA logical thinker who loves solving technical challengesPride in your work and committed to qualityTPBN1_UKTJ

Oversees and performs the facilities maintenance tasks of a technical services and property maintenance function to both the internal and external parts of buildings, grounds, amenities, and common areas across a group of properties to meet the Companys requirements for building standards, health and safety, statutory compliance and overall asset functionality. Key Role Responsibilities • Assigns and ... ZIPC1_UKTJ

Sureserve provide market leading compliance and energy services across the UK, with close to 4000 employees working from over 20 offices.Sureserve is a trusted partner for housing associations, local authorities, and residents, delivering high-quality compliance and energy services. Our focus on energy efficiency, safe and compliant homes, and enhanced quality of life makes us a leader in the industry. With nationwide reach, regional expertise, and a commitment to excellent service, we are well-positioned to support our clients now and in the futureWe're growing fast and need two skilled and experienced gas installers to join our team covering Redhill, Surrey, Suffolk and Kingston area. You'll join an already amazing team and be involved in some great projects.Role Overview:Complete gas installation work encompassing all aspects to ensure work is finished to highest standards set by client and Sureserve. This work will be conducted in individual dwellings relating to specific contracts the company currently holds, the work will have been assessed by an inspector / supervisor and as such all materials and scope of works will have been identified and organised ready for you to perform your tasks.Key Responsibilities: Day-to-day management of the installation you have been assignedComplete the installation to the specification of the survey and the client criteria and to all governing body regulationsReport any reasons why the above cannot be achieved to your installation supervisorComplete all contract-specific paperwork at the time of the installation and acquire all necessary signaturesCarry out your duties professionally and courteously, show awareness and respect to other people's property and maintain a high level of cleanliness in all areas of your workReturn to any recalls at the request of your installation supervisorComplete the assigned installation within the set time frame, any potential failure to do this must be reported your Installation Supervisor at the earliest opportunityWear company-issued uniform at all times including any required PPEComplete all paperwork including timesheets and H&S Monitoring formsEnsure Health & Safety & Environmental procedures and standards are adhered toEnsuring all certification and documentation is completed accurately.Skills & Experience Valid domestic and/or commercial gas qualifications. As a minimum, successful candidates must have the following: CCN1, CENWAT, HTR1, CKR1 (essential)Valid UK driving licence (essential)Previous practical experience in gas installation within a domestic capacitySolid understanding of gas safety regulations and industry standardsStrong problem-solving skills and the ability to work independentlyA professional and friendly attitude with the ability to forge strong relationships with both clients and tenantsWhat we offer?We offer a range of benefits designed to support your lifestyle whilst working for Sureserve and outside of work, some of these include: £38,000 per annum + price ratesCompany vehicle and fuel card suppliedUniform, PPE & mobile device suppliedContributory pension schemeLife assurance20 days + Bank holidays (service based increasing holiday scheme)Enhanced maternity, paternity, adoption leave and other family friendly policiesSureserve Benefits Hub, accessing over 1000 retail discountsVirtual GP service, available for employees and immediate familyEmployee Assistance Programme (EAP)Bike2Work SchemeEV Car SchemeEmployee engagement events and "Employee Voice" programmesStrong opportunities for career growth and development"Sureserve Legends" - celebrating the fantastic ways in which our employees live our valuesCommitted to Diversity & InclusionSureserve is an equal opportunities employer, dedicated to nurturing a diverse and inclusive work environment. We are committed to equal employment opportunity regardless of race, colour, ancestry, religion, sex, national origin, sexual orientation, age, citizenship, marital status, disability, gender identity, or Veteran status. We are committed to developing talent at all levels, ensuring equality, diversity, and inclusion in the way we work and in the communities in which we work, and making sure that every one of our people, clients and customers has the opportunity and support to fulfil their professional and personal potential.Reasonable AdjustmentsAs part of our commitment to inclusivity, we offer reasonable adjustments throughout the recruitment process for individuals that may require them. If you feel you need any adjustments please contact .Pre Employment ChecksSuccessful applicants will be subject to eligibility checks with a 3rd party, including right to work in the UK and DBS background checks.TPBN1_UKTJ

EV Charging Electrician | London Croydon or Watford and surrounding areas (UK travel required) | Full Time | £42,000 basic (£57,000 OTE incl. overtime/bonus) + ~£15,000 overtime potentialOur client provides a range of renewable energy services to domestic and commercial clients throughout the UK. Due to rapid growth in the EV sector and multiple contract wins, they are now expanding their team.Engineers are at the heart of their business, and you will receive full support with ongoing training and clear opportunities for career progression.You'll work on a diverse range of domestic and commercial EV charging installations across the UK, partnering with leading organisations within the electric vehicle sector. The role offers a varied workload, predominantly carrying out home installations, while also supporting workplace charging, commercial infrastructure projects, and service and maintenance work, providing excellent experience across multiple environments.Key ResponsibilitiesDemonstrate excellent knowledge of domestic, commercial & industrial electrical and EV installationsCarry out inspection and testingInstall EV charge points in commercial and domestic propertiesService and maintain EV charge pointsDiagnose and repair faults on EV charge points (training will be given if needed)Install general power and lighting systemsInstall containment systems including tray, trunking & ladder rackWork independently or as part of a teamCarry out domestic and commercial electrical surveysRequirementsEssentialNVQ Level 3 qualification or JIB registered Gold Card18th Edition Wiring Regulations qualificationC&G 2919 EVSE Installation Course or equivalentMinimum of 5 years' electrical experienceMinimum of 1 year's commercial EV charger experienceFull UK driving licence with less than 6 pointsProven or extensive experience in all aspects of installation worksA moderate degree of computer literacyA fantastic attitude to workEnthusiastic, self-motivated with a flexible approach to problem-solvingHard-working with a passion for assisting customersAble to organise your own workloadExcellent attention to detailEager to develop and progress your careerDesirable2391 Test and Inspection or equivalentWhat's On OfferGreat salary (£42,000 basic, £57,000 OTE with overtime/bonus)Strong earning potential with additional overtime (estimated £15,000 per year) availableStandard working hours of 8:00am 4:30pm, Monday to FridayEnhanced overtime rates with opportunities for evening and weekend work, depending on customer demand25 days annual leave plus bank holidaysCompany van & fuel cardPhone and tablet or laptop supplied for work useComprehensive company induction covering systems, processes, health & safety procedures, customer service standards, charger-specific training and isolation processesOngoing technical support from an experienced management team, with additional training provided to support business and customer requirementsExcellent long-term career progression opportunities within a growing sectorPerformance-based bonus schemeAdditional InformationEmployment is subject to satisfactory references, a DBS check and proof of the right to work in the UK.Whats next? Its easy! Click APPLY now! We cant wait to hear from you!Your data will be handled in line with GDPR.TPBN1_UKTJ

Job Overview Flat RooferWe are seeking a skilled and dedicated Flat Roofer to join our construction team. The ideal candidate will be responsible for installing, repairing, and maintaining flat roofs on a variety of commercial and residential buildings. This role requires a strong understanding of roofing systems, safety procedures, and the ability to work efficiently both independently and as part of a team. The position offers an excellent opportunity for individuals with experience in construction-related trades to develop their skills further within a professional environment.Duties Flat RooferInstall, repair, and maintain flat roofing systems using appropriate materials and techniquesRead and interpret schematics, technical drawings, and specifications to ensure accurate installationOperate power tools, hand tools, welding equipment, and fabrication machinery safely and effectivelyPerform heavy lifting of roofing materials and equipment to facilitate installation processesUse carpentry, masonry, plumbing, and other construction skills as required during roofing projectsConduct inspections to identify potential issues or defects in roofing structuresEnsure all work complies with safety standards and building codesCollaborate with team members to complete projects on time and within budgetMaintain a clean and organised work environment at all timesExperience Flat RooferProven experience in roofing, construction, or related trades such as carpentry or masonryKnowledge of schematics, welding techniques, and fabrication processes is desirableFamiliarity with the use of hand tools, power tools, and specialised roofing equipmentAbility to perform heavy lifting safely and efficiently during installation or repair tasksExperience working with plumbing or masonry is advantageous but not essentialStrong understanding of health and safety regulations relevant to roofing workThis role offers an engaging opportunity for experienced roofers seeking to specialise in flat roofing systems. Candidates should be organised, safety-conscious, and capable of working in physically demanding environments. A commitment to quality workmanship is essential for success in this position.TPBN1_UKTJ

Room Leader - Early Years Setting, Sutton We are seeking a dedicated and experienced Room Leader to join a beautiful Early Years setting based in Sutton. This is an excellent opportunity for a passionate childcare professional who is committed to delivering outstanding care, learning, and development opportunities for young children. This is a full-time, all-year-round position, working within either the baby room or toddler room, depending on your skills and experience. Key responsibilities include: • Leading and supporting a team to provide high-quality care and education., • Creating a safe, stimulating, and nurturing environment for children., • Working closely with management to maintain high standards across the setting., • Supporting children's learning, development, and wellbeing in line with the Early Years Foundation Stage (EYFS)., • Building positive relationships with parents, carers, and colleagues., • Ensuring safeguarding, health and safety, and nursery policies are consistently followed. We are looking for someone who: We would also consider an Early Years Practitioner who is ready to take the next step in their childcare career. The ideal candidate will be enthusiastic, organised, and confident in leading by example, with a genuine passion for supporting children during their early development. If you are an experienced Room Leader-or an ambitious Early Years Practitioner looking for your next opportunity-we would love to hear from you. Connaught Resourcing operates as an Employment Business and an Employment Agency. We are a committed equal opportunities employer who respect and value cultural diversity. Connaught Resourcing will carry out background checks including referencing and where required an Enhanced or Standard DBS Disclosure as part of our recruitment and selection procedures.

OLE Technician We are currently recruiting experienced OLE Technicians to join our rail infrastructure team, supporting a range of overhead line maintenance and inspection projects across the UK. This is an excellent opportunity to secure ongoing work with a well-established organisation delivering essential rail infrastructure projects.Shift PatternDays: 07:00 15:00Nights: 22:00 06:0045 shifts per weekAdditional weekend shifts may be available, although these are not guaranteed.Key ResponsibilitiesCarry out inspections and assessments of Overhead Line Equipment (OLE).Perform planned and reactive maintenance activities.Replace damaged or worn OLE components.Identify, report and record faults accurately.Complete safety documentation, inspection reports and maintenance records.Ensure all work is completed safely and in line with Network Rail standards and procedures.Work effectively as part of a team while maintaining the highest safety and quality standards.Essential RequirementsMinimum OLEC 2 competency.Previous experience working in an OLE Technician or similar role.Experience carrying out OLE inspections, assessments and maintenance.Ability to complete safety forms and fault reports accurately.Strong commitment to health, safety and compliance.Hold, or be willing to undergo, a Network Rail Standard Medical demonstrating fitness to work alone.DesirablePrevious Network Rail experience.Knowledge and understanding of Network Rail standards and procedures.What We OfferCompetitive rates of pay.Regular day and night shifts.Potential for additional weekend work.Ongoing opportunities on rail infrastructure projects.Supportive team environment with a strong focus on safety and quality.If you're an experienced OLE Technician looking for your next opportunity, we'd love to hear from you. Apply today with your up-to-date CV, and a member of our recruitment team will be in touch.TPBN1_UKTJ

The Sureserve Group of businesses provides market-leading compliance and energy services across the UK, with 4000 employees working from over 20 offices.Sureserve Compliance South, part of the Sureserve Group, delivers heating services within the social housing sector across London & the South East. We support our clients across domestic gas, commercial gas, renewables, and electrical services. We are London's largest, most successful gas contractor, focusing on long-term contracts with our clients to offer our staff job security and progression opportunities.RoleThe purpose of the role is to carry out electrical installation testing in our customer's properties, and produce reports to meet the requirements of BS7671 while always maintaining a safe working environment. Carry out periodic inspections of clients' electrical installations in accordance with the current edition of BS7671Produce Electrical Installation Condition Reports (EICR) which meets the requirements and quality standards of clients and external accrediting bodies (e.g., NICEIC)Perform other electrical tests and inspections, and produce the appropriate documentation in accordance with the current edition of BS7671Always adhere to Company Health & Safety Policies and ProceduresKeep abreast of changes and amendments of standards, regulations, and best practices within the electrical industryComplete follow-on remedial works, where requiredInstallation/replacement of domestic fire protection systems to LD2/LD3.The successful candidate will have City & Guilds NVQ level 3City & Guilds 2391 or 2394/5City & Guilds 2382 18th EditionFull UK Driving LicenceExperience within Social Housing desirable, but not essentialExperience delivering high levels of customer serviceThe ability to work with a diverse customer baseWhat we can offer youWe offer a range of benefits designed to support your lifestyle whilst working for Sureserve and outside of work, some of these include: Competitive salaryContributory Pension schemeLife assurance28 days annual leave inclusive of bank holidays, rising 1 per year of service to a max of 33 daysEnhanced maternity, paternity, adoption leave, and other family friendly policies such as carer's leave, neonatal leave, IVF, and assisted conception leave.In addition, the role offers: Sureserve Benefits Hub, accessing over 1000's retail discountsVirtual GP service, 24/7, 365 days, available for employees and your immediate familyEmployee assistance programme (EAP), available 24/7. 365 days, for employees and your immediate familyBike2Work schemeHome & Electronics - salary sacrifice purchase schemeSureserve is an equal opportunities employer, dedicated to nurturing a diverse and inclusive work environment. We are committed to equal employment opportunity regardless of race, colour, ancestry, religion, sex, national origin, sexual orientation, age, citizenship, marital status, disability, gender identity, or Veteran statusReasonable adjustmentsAs part of our commitment to Inclusivity, we offer reasonable adjustments throughout the recruitment process for individuals who may require them. If you feel you need any adjustments, please contactPre-employment checksSuccessful applicants will be subject to eligibility checks with a 3rd party, including the right to work in the UK and DBS checksTPBN1_UKTJ

Senior Contracts Manager – Roofing Job Title: Senior Contracts Manager – Roofing Job reference Number: Industry Sector: Contracts Supervisor, Supervisor, Assistant Contracts Manager, Contracts Manager, Contracts Manager, Senior Contracts Manager, Commercial Manager, Operations Manager, Roofing Technician, Site Technician, Site Manager, Site Supervisor, Project Manager, Roofing, Refurbishment, Commercial Roofing, Commercial Roofs, Flat Roofing, Pitched Roofing Area to be covered: London & South East Office location: Kingston upon Thames Remuneration: £60,000 - £75,000 Benefits: £5000 car allowance, pension & 25 days annual leave The role of the Senior Contracts Manager – Roofing will involve: • Senior Contracts Manager positions dealing with the refurbishment of commercial flat & pitched roofing and cladding systems, • Manage construction contracts from award to completion, ensuring delivery on time, within budget, and to specification., • Lead and coordinate site operations, including subcontractors, labour, materials, and suppliers., • Control project finances, including budgets, forecasting, variations, invoicing, and profitability., • Ensure compliance with contract requirements, Health & Safety regulations, and quality standards., • Maintain strong client relationships while providing effective leadership, supervision, and development of site teams. The ideal applicant will be a Senior Contracts Manager – Roofing with: • Must have extensive roofing refurbishment/replacement experience as a Contract Manager, • Ideally worked on large scale projects, • Ideally have experience with JCT contracts, • Strong health & safety and quality management experience, • Proven experience managing teams of sub-contractors, • Sound understanding of Health & Safety legislation, • Positive attitude with a willingness to learn, • Resilient individual who can deal with queries in a professional manor, • Excellent communication across all levels both written and verbal, • IT literate (Microsoft Office), • Full UK driving license Mitchell Maguire is a specialist Construction Management Recruitment Consultancy, dealing exclusively with Construction Management Jobs, Construction Management vacancies and Construction Management Positions within: Contracts Supervisor, Supervisor, Assistant Contracts Manager, Junior Contracts Manager, Contracts Manager, Roofing Technician, Site Technician, Site Manager, Site Supervisor, Project Manager, Roofing, Refurbishment, Commercial Roofing, Commercial Roofs, Flat Roofing, Pitched Roofing

UK HSE Manager Location: Milton Keynes (MK10)Up to £70,000 p.a. + Car Allowance + Bonus Are you passionate about Health, Safety, and Environment (HSE) management? Do you have a strong background in ensuring workplace safety and environmental compliance in the manufacturing sector? If so, we have an exciting opportunity for you to join our global plastics manufacturing team as a Regional HSE Manager ... ZIPC1_UKTJ

Mechanical Project Manager / Senior Mechanical Project Manager | M&E Building Services | South London | £75,000-£95,000 + PackageThis is a fantastic opportunity for an experienced Mechanical Project Manager or Senior Mechanical Project Manager to join a respected M&E Building Services contractor delivering exciting and varied projects across London and surrounding areas.Projects span the commercial, commercial fit-out, healthcare, education, residential, mixed-use, industrial, and public sector markets, with typical project values ranging from £1m-£4m, alongside larger projects where applicable.This role offers the opportunity to join a business with a strong reputation for quality, repeat business, and long-term client relationships, whilst benefiting from a supportive culture and genuine career progression opportunities.The CompanyThis established M&E Building Services contractor has built an excellent reputation for delivering high-quality mechanical building services projects across a diverse range of sectors.Known for its collaborative and down-to-earth culture, the business continues to secure repeat business from long-standing clients and offers employees genuine responsibility, autonomy, and opportunities to progress their careers.The Role Mechanical Project Manager / Senior Mechanical Project ManagerThe successful candidate will play a key role in delivering mechanical building services projects from pre-construction through to successful completion and handover.Working closely with clients, consultants, subcontractors, and internal teams, you will ensure projects are delivered safely, efficiently, on programme, and to the highest standards.Responsibilities will include:Managing mechanical building services projects from inception through to handoverCoordinating labour, subcontractors, suppliers, and site teamsManaging programme delivery and project performanceMaintaining strong client and stakeholder relationshipsEnsuring quality, health and safety, and technical compliance requirements are metSupporting commercial performance and project reportingRequirementsExperience working as a Mechanical Project Manager, Senior Mechanical Project Manager, Mechanical Contracts Manager, or similar role within M&E Building ServicesStrong technical understanding of HVAC, pipework, ventilation, plant, and associated mechanical servicesExperience delivering building services projects across one or more sectors including commercial, fit-out, healthcare, education, residential, industrial, or mixed-use developmentsStrong organisational, communication, and client-facing skillsGood commercial awarenessFull UK Driving LicenceRemuneration Package Mechanical Project Manager / Senior Mechanical Project Manager£75,000-£95,000Car Allowance or Company VehicleAnnual BonusPensionPrivate HealthcareLife AssuranceTraining and Development OpportunitiesGenuine Career Progression OpportunitiesAdditional Benefits PackageNext StepsIf you would like to be considered for this Mechanical Project Manager / Senior Mechanical Project Manager position, please apply online today, or contact Rob at David Leslie Ltd for an informal and confidential discussion.About David Leslie LtdDavid Leslie Ltd is a family-run construction recruitment consultancy with over 20 years experience connecting professionals and employers across the UK. Specialising in the Building, Fit-Out, and M&E Building Services sectors, our approach is built on trust, integrity, and long-term partnerships, ensuring both clients and candidates receive a service that is personal, transparent, and expertly delivered.This role would suit candidates currently working as:Mechanical Project Manager, Senior Mechanical Project Manager, Mechanical Contracts Manager, M&E Project Manager, Mechanical Building Services Manager, MEP Project Manager.TPBN1_UKTJ

Maintenance Technician/Operative, Croydon, CR0Temporary, 4-8 weeks, £16.50ph (£34K)We are looking for a proactive multi skilled Maintenance Operative for a luxury apartment building in Croydon. In this static role, you will play a key part in delivering an outstanding living experience by ensuring all maintenance and repair requests within the property are handled efficiently and effectively.This is a hands-on position where no two days are the same—perfect for someone who takes pride in their work and enjoys problem-solving in a fast-paced environment.DutiesDeliver excellent customer service, working closely with colleagues and management.Carry out reactive and preventative maintenance across the property.Coordinate and monitor onsite contractors to ensure work is completed to a high standard.Complete planned maintenance tasks, including:Fire alarm and emergency lighting testingFire extinguisher checksWater hygiene tasks (flushing & temperature monitoring)Shower head descalingHealth & safety inspectionsConduct regular building patrols to identify maintenance issues and safety risks.Perform scheduled flat inspections and promptly resolve any issues identified.Maintain accurate maintenance records and log all issues within the system.Ensure compliance documentation is up to date (gas safety, PAT testing, wiring certification, etc.).Follow all health & safety procedures, including risk assessments and permit-to-work systems.Engage professionally with residents, showing empathy and understanding.Report any welfare concerns immediately to management.Support the wider team with reception/admin duties when required.What We're Looking ForExperience in general maintenance, including plumbing and/or electrical work.A reliable and self-motivated individual who takes ownership of their work.Strong understanding of health & safety legislation.Ability to prioritise workload and work independently as well as part of a team.A positive, customer-first attitude, with the ability to build rapport with residents.If you are a practical, solution-driven individual with a passion for maintenance and customer service, we would love to hear from you.Apply today!TPBN1_UKTJ

Electrical and Electronic EngineerLocation: Mitcham, UKWorking Hours: Full TimeSalary: £65,000 per annumOur client is a global supplier to the Composite & Coating Industry with 19 manufacturing sites and 5 technology centres in 12 countries. The company is one of the world's largest suppliers of unsaturated polyester resins for composites and a leading supplier of coating resins for a wide variety of markets and applications.The RoleThey are seeking an Electrical and Electronic Engineer tomanage the maintenance of the plant and buildings at the Mitcham facility.Administer and maintain this system and the records, keeping all Plant equipment in a safe and operable condition with minimum downtime, making best use of human resources to achieve aims and minimising the use of contractors and consultants.This role will be responsible for managing the maintenance and capital budgets.ResponsibilitiesExecute capital plan as best defined by completing assigned projects on schedule and within budgetResponsible for the capital budget management, as well as for the capital planning, CEAR submission and all project-related activitiesResponsible for cash flow forecasting of all project spending and closing projects upon receipt of the last invoice associated with each projectEnsure that all abatement equipment is maintained to ensure regulatory compliance and allow planned operation with no environmental violationsEnsure that all maintenance standards, procedures and records are in compliance with the Regulating Authority and Polynt internal requirements, e.g. LEV, Lifting Equipment, Pressure inspection, boiler inspections, asbestos register, mechanical integrity, etcCarry out Process investigations, in conjunction with the operations team, to ascertain that the equipment and processes are operated as efficiently as possibleEnsure that all Engineering activities are carried out according to procedure and that all EHS practices are strictly adhered to (by own staff and Contractors) with the target of achieving a zero accident rate in the maintenance departmentPurchase (and control the purchasing by other members of the team) all maintenance services and materials within the constraints of the maintenance budgetControl inventory of spares and consumablesCarry out project design for plant modifications or major maintenance operations (or manage the design if done by external contractors)Facilitate and participate in PHA studies, estimate, prepare authorisation and justification documentationProcure and project manage all works up to and including mechanical and, in co-operation with plant chemists and other operations management, commission such modifications when authorisedManage the operation of the utilities at the Mitcham Facility, including the management of the efficient and safe use of energyUtilities include steam boilers, thermal oil heaters, air compressors, nitrogen systems, cooling towers, chillers, process water systems, incinerators, catalytic oxidisers and associated office and laboratory facilitiesAct as the PI administrator on siteKeep updated and well-organised the plant documentation, such as P&IDs, Electrical loops drawings, Equipment filesWhat We're Looking ForDegree level or equivalent in Electrical or Electronic Engineering, or at least 5 years' experience in chemical, manufacturing or a related engineering discipline.Experience working in a chemical manufacturing environmentHigh level of competence in mechanical maintenanceKnowledge of integrated systems (Instrumentation / PLC/ HMI (general))Experience in managing and controlling a maintenance budgetClear understanding of risk management and respect for the hazards associated with a chemical plantAble to clearly communicate with other colleagues (intervention status, report) / interaction with other servicesSelf-motivated, quality and safety conscious individualAbility to manage a maintenance team and outside contractorsWhat's in It For You23 Days of annual leaveAnnual bonus (subject to company achieving its EU EBITDA target)PensionRegular health checksOn-site parkingWhat's next? It's easy! Click “APPLY” now! We can't wait to hear from you!Your data will be handled in line with GDPR.TPBN1_UKTJ

Job Type: Full-Time, Permanent, All-Year RoundReporting to: Bursar We are seeking an experienced and proactive Premises Manager to lead the maintenance, operations, health & safety, security, transport, and grounds functions across a busy and successful independent school. This is a senior operational role with responsibility for ensuring that a large educational site, sports facilities, and grounds are maintained to the highest standards. The successful candidate will play a key role in supporting the school's day-to-day operations while helping to deliver future improvement and refurbishment projects. You will lead a dedicated premises, grounds, and transport team, manage contractor relationships, oversee compliance obligations, and work closely with senior leaders to provide a safe, secure, and welcoming environment for pupils, staff, parents, and visitors. Key Responsibilities • Lead and manage the Premises, Grounds, Cleaning and Transport teams., • Oversee all aspects of the maintenance, repair, servicing and operation of school buildings and grounds, • Manage building improvement, refurbishment and development projects., • Ensure full compliance with Health & Safety, Fire Safety and statutory requirements., • Produce and maintain risk assessments and compliance records., • Manage premises and grounds budgets, • Coordinate planned preventative maintenance programmes and holiday works., • Oversee site security arrangements, including participation in an out-of-hours call-out rota., • Manage external contractors, ensuring works are completed safely and to specification., • Oversee school transport operations through the management of the Transport Manager., • Ensure facilities are prepared for school events, meetings, performances and special occasions., • Work collaboratively with teaching and support staff to support the wider school community. About You We are looking for a highly organised and hands-on facilities professional who combines strong technical knowledge with excellent leadership skills. Essential Requirements • Significant experience managing premises, facilities, estates, or property operations., • Proven experience leading teams and managing contractors., • Experience overseeing refurbishment, maintenance, or construction projects., • Strong knowledge of Health & Safety and statutory compliance requirements., • Excellent organisational and administrative skills with a strong attention to detail., • Strong IT skills, including Microsoft Office applications., • Full UK driving licence (D1 licence desirable or willingness to obtain). Desirable Qualifications & Experience • Facilities Management qualification or equivalent professional experience., • Experience working within an educational environment., • First Aid qualification or willingness to obtain training upon appointment. Benefits include • 5 weeks' annual leave plus bank holidays., • Generous pension scheme., • Free lunch during term time. To apply, please submit your CV

GLL is looking for a Fitness Instructor based at Sutton Sports Village, Sutton Surrey. If you have the skills and ambition to join us as a Fitness Instructor, there has never been a more exciting time to join us. This is more than a Fitness Instructor job, it's a career. As a Fitness Instructor, part of your role is to inspire people to train independently and keep coming back helping them understand their fitness aspirations. It all starts with an induction, for you to understand someone’s ability and ambitions and ultimately, devise a bespoke programme that suits their needs. As a real people-person, this will come naturally as you quickly build people’s trust and confidence. If you love variety, you’ll thrive here, as you never know who you’ll be supporting next. A typical day could be anything from providing a personal service in the gym and offering workout advice to checking the equipment and even teaching classes. That means we’re looking for a Fitness Instructor with physical fitness, combined with a can-do attitude and the eye for detail needed for paperwork. An obvious passion for all things fitness will need to shine through all you do too, so that you can make a positive difference to people’s lives. What you’ll do: • Collecting and checking information, relating to individual clients, • Analysing information relating to individual clients, • Identifying and agreeing smart short, medium and long term goals, • Planning, instructing and evaluating safe and appropriate exercise sessions., • Providing 1-2-1 or group inductions and general exercise programmes, including the introduction to new equipment where appropriate., • Teach classes or small group training. Training will be given for them to be able to do this., • Selecting relevant exercises and designing appropriate programmes which address safety at all times, • Producing suitable programme cards for a range of clients/members, • Suggesting relevant exercise adaptations to allow for individual client difference or needs., • Using logical and progressive teaching methodologies to introduce a range of exercises in relation to client goals., • Selecting and/or correctly demonstrating a variety of training methods that can be used by clients/members., • Providing clients/members with general advice on how to progress their individual programmes., • Providing assistance to clients/members at all times in order to correct unsafe technique where required., • To positively interact and motivate clients/members using appropriate strategies in order to promote retention and adherence to exercise. What you need: • A minimum NVQ level two Fitness Instructor Qualification, • Group Cycle CPD or Qualification, • Experience of class delivery, • A good positive image and the ability to provide welcoming, helpful and professional service to keep customers returning week after week., • Proactively market and promote the Group Cycle classes, • Ability to engage with all customers to actively encourage participation in all our service and activities As a charitable social enterprise and cooperative owned by our staff, GLL is a unique organisation for you to have a career with! The basics: This is a Flexible position and hours of work will be negotiated with you in line with the needs of the service, working from home is not possible in this role. We are an accredited Living Wage employer with industry leading rates of pay We can offer a career, not just a job with extensive Learning & development support available. A uniform will be supplied and must be worn GLL is Values Driven, not Profit Driven. We work hard to benefit the communities we operate in. As a staff owned organisation you will be given the opportunity to join the Society and have a stake in your business Additionally GLL offers employees a range of employment benefits: • Access to a pension scheme., • Health Assurance and access to Counselling services, • Access to the tax efficient Ride to Work bicycle purchase scheme., • Free annual eye tests, • Discounted nationwide (over 200 centres) inclusive leisure centre membership for you and your partner. This includes GLL Extras! GLL Society benefits (if you choose to join the Society after your probation period) include: • The right to stand for the Society board and to vote for board members to represent you, • Access to team building and fun events such as Treks, Concerts outings etc, • Access to a range of benefits exclusive to our people – ask your line manager for details or check out the Intranet About GLL: As the UK’s largest leisure operator and charitable social enterprise, we offer a range of careers for everyone in our local communities. We manage over 400 facilities across England, Wales, and Northern Ireland, including public sport and leisure centres, elite sporting venues, libraries, and children’s centres. Our people are from the communities we serve and help us make real changes in their local area. One of our core values is ‘More than a Job’, because working with us opens a wide range of possibilities and opportunities for you, starting with how you work with us.?To make sure we are having a positive impact on our people, we also offer some flexible and part-time working options so you can make sure your new job works for you. Subject to vacancies, whether you are after a contractual commitment and a regular work schedule or the freedom of flexible hours, you may be able to choose an arrangement that works best for you and play your part in improving the health and wellbeing of your community. We offer two different types of work arrangements: • A permanent employment contract - part time and full time, • A flexible worker engagement by joining our flexible worker pool If you are looking for a regular number of hours that you can work and are flexible to meet the needs of a 7 day a week service, then a full-time or part-time permanent contract might be the right choice for you. So whether your ambitions lie in sport and leisure, events & catering, health & beauty, corporate support or working with children, you’ll be able to find your ideal new job at GLL. Passionate about seeing our communities thrive, we invest back into our facilities, projects a

SMART Repair Technician – Hedin Automotive London Mercedes-Benz Division Hedin Automotive London is a premier Mercedes-Benz partner in the UK, operating across Brooklands, Croydon, West Bromley, and Dartford. We are committed to delivering exceptional automotive experiences and maintaining the highest standards of customer care. We are currently seeking a skilled and dedicated SMART Repair Technician to join our team at our Croydon site. In this role, you will be responsible for carrying out high-quality external cosmetic repairs on customer vehicles and used-car stock, ensuring every vehicle is restored to an exceptional standard. About You We’re looking for someone who brings: Strong technical skills in external vehicle cosmetic repairs Excellent attention to detail Confident customer relationship-building abilities The capability to work efficiently under pressure A positive, team-focused attitude Key Responsibilities Completing high-quality external cosmetic vehicle repairs, such as scratch, scuff, dent, and chip repair Working in line with all safety policies and procedures Delivering excellent customer service throughout Representing both the Hedin Automotive and Mercedes-Benz brands with professionalism Requirements Proven experience as a SMART Repair Technician or within a Bodyshop environment performing detailed external cosmetic repairs Committed to delivering work to the highest standard A valid UK driving licence About the Role Full-time, permanent position 40 hours per week Monday – Friday, 8:00 am – 5:00 pm What We Offer £32,987.50 and achievable OTE £50K Access to health and pension schemes A supportive and collaborative working environment Employee discounts on vehicle purchases and servicing Life assurance Access to an Employee Assistance Programme and Mental Health First Aiders Opportunities for personal and professional development Hedin Automotive London Ltd is an equal opportunities employer promoting an inclusive workplace free from discrimination. All successful applicants will be subject to background checks, including address and criminal history checks. To find out more about our organization, visit our website

GLL wish to recruit a Lead Children's Activity Instructor to work at Thornton Heath Leisure Centre, in Croydon, for our Holiday Play Scheme and Birthday Parties. If you have the skills and ambition to join us as a Children's Activity Instructor there's never been a more exciting time to join us. This is more than a Children's Activity Instructor job, it's a career. We believe that children should be active, stimulated and sociable. That's why at GLL, we run Holiday Play Schemes at our Better Leisure Centres. The schemes run during school holidays and provide a safe, yet fun haven for children from 5+ years old. As well as being enjoyable for the children, they're very convenient for working parents too. Pease note this position is based at Thornton Heath Leisure Centre, in Croydon. Working as part of a team, you'll create a structured, safe and fun environment using the facilities around you. You'll be confident in leading children through a mix of activities that can include anything from football, basketball, swimming, trampolining and even bouncy castles. You'll encourage an environment of respect and friendship amongst the children. Essential requirements for the role: • Experience of working with children of 5+ years old, • Basic knowledge of safety with regards to childcare, • Friendly and approachable as well as being imaginative, creative and a positive role model to the children in the scheme If you have what it takes to keep children active and happy at our Holiday Play Schemes, apply now. As a leader within the leisure industry, we can also offer scope to progress your career, and job variety like nowhere else. In return, you will get: • Industry leading rates of pay, • Discounted membership at our leisure centres, • Discounts across thousands of retailers (GLL Extras), • A fantastic pension scheme, • 25% off Red Letter Days, • 25% off Buy A Gift, • 20% off GLL spa experience treatments and associated products., • Ride to work scheme, • Free eye tests and discounted glasses, • The opportunity to join the GLL Society and have a say in how we are run plus associated social events, • Exclusive discounts on our villas in Portugal, • Exclusive discounts on our Ski chalets in Bulgaria, • Health assurance, • Career pathways, professional development are just the start. To ensure you stay at the top of your game, we provide training with practical and theory elements too. About GLL: As the UK’s largest leisure operator and charitable social enterprise, we offer a range of careers for everyone in our local communities. We manage over 400 facilities across England, Wales and Northern Ireland, including public sport and leisure centres, elite sporting venues, libraries and children’s centres. Our people are from the communities we serve and help us make real changes in their local area. To make sure we’re having a positive impact on our people, we also offer some flexible and part-time working options so you can make sure your new job works for you. So whether your ambitions lie in sport and leisure, events & catering, health & beauty, corporate support or working with children, you’ll be able to find your ideal new job at GLL. Passionate about seeing our communities thrive, we invest back into our facilities, projects and people and are Investors in People Silver Award employer. We are an inclusive employer. We seek and welcome diversity in our teams. All pay rates are subject to skills, experience, qualifications and location.

Kitchen Manager - South Croydon Daytime Hours Only | Great Work-Life Balance We are looking for an experienced and motivated Kitchen Manager to lead a busy restaurant kitchen in the South Croydon area. This is a fantastic opportunity for someone passionate about food, customer service, and team leadership - all while enjoying daytime-only shifts with no late nights. The successful candidate will oversee the daily running of the kitchen, ensuring high standards of food quality, cleanliness, compliance, and customer satisfaction are consistently delivered. Kitchen Manager - Key Responsibilities: • Lead, motivate, and support the kitchen team in a fast-paced environment, • Ensure meals are prepared and presented to a consistently high standard, • Maintain excellent food hygiene and health & safety standards, • Manage stock, budgets, and kitchen operations efficiently, • Support training and development within the team, • Help create a positive, productive, and enjoyable working environment Kitchen Manager - What We’re Looking For: • Previous experience in a kitchen leadership or management role, • Strong understanding of food safety and kitchen compliance, • Excellent organisational and communication skills, • Commercial awareness and ability to work within budgets, • A hands-on approach with a positive and adaptable attitude, • Passion for delivering excellent customer experiences Kitchen Manager - What’s On Offer: • Daytime hours only - excellent work-life balance, • Staff discounts and company benefits, • Ongoing training and development opportunities, • Supportive and friendly working environment, • Opportunity to join a well-established and growing business If you’re an enthusiastic Kitchen Manager looking for a fresh opportunity with better hours and a supportive team culture, we’d love to hear from you.

Perfect Placement UK Ltd is recruiting on behalf of our client, a manufacturer-owned dealership group, and we are seeking an Aftersales Manager for their Croydon, Surrey site. The Aftersales Manager role is responsible for leading the aftersales department in a busy, customer-focused workshop environment, driving performance, team development and measurable improvements.Benefits of an Aftersales Manager: • £45,000 basic salary with a realistic £67.5k OTE based on performance, • 42 hours per week, Monday to Friday (8am–6pm), • Manufacturer-owned dealership with a well-established team aligned to a vehicle manufacturer group, • Company car scheme including insurance, servicing, breakdown and tyre cover, • Pension contribution up to 7%, • 22 days annual leave rising to 26 with continued service, plus bank holidays, • Single private medical and additional retail discounts, • Employee Assistance Programme and occupational health support, • Discounts on new cars and a range of aftersales services including MOT, body shop, parts, services and tyres, • Training and development opportunities to support career progressionDuties of an Aftersales Manager:, • Manage the Aftersales Manager workshop technician team to maximise efficiency, drive sold hours and improve first time fix, • Lead customer-facing Aftersales Manager activity to achieve commercial targets while maintaining exceptional customer service, • Drive use of new digital systems and processes within the dealership digitalisation strategy, • Develop team skills and knowledge to support clear career progression, • Optimise operational processes across the customer journey, including vehicle health checks, • Ensure compliance with group financial processes, DVSA MOT requirements and all relevant Health & Safety regulations, • Monitor key performance indicators and take action to hit short, medium and long-term goals, • Contribute to improvements across the department and wider dealershipRequirements for an Aftersales Manager:, • Previous experience in a busy dealership environment, • Proven experience as an Aftersales Manager delivering results, • Ability to manage a team of at least 20 people, • Multi-brand experience preferred, • Strong leadership and coaching skills focused on service standards, • Commercial awareness and capability to drive upsell without compromising customer experience, • Confident adoption of new processes and systems, • Strong understanding of compliance, process adherence and Health & SafetyContact Liam Buffenbarger, Automotive Recruitment Specialist at Perfect Placement covering Croydon and Surrey, today to discover more about this fantastic opportunity.Perfect Placement are the UK’s Leading Automotive Recruitment Agency so if you are looking for a Job get in touch today.

Head Chef About us: We're always on the look out for talented Head Chefs for our businesses. You'll have experience working with fresh food and running all aspects of a kitchen. Our Head Chefs write their own menus and create their own dishes using seasonal produce, allowing them to put their own stamp on the business. We have sites across South West London and beyond so if you'd like the chance to show off what you can do then apply now. Being a Head Chef at Young's: We believe every pub should be different. This means that you'll be writing your own recipes that match the food vision of your business using fresh seasonal ingredients. The food vision could be all about showcasing local produce, country pub classics, seafood, small plates and sharers, dry-aged meat - each pub is different and its up to you as head chef to put your own creative stamp on that vision. We work with fresh, seasonal produce, so the menu should constantly evolve to showcase these fantastic ingredients when they are at their best. Premium fresh food crafted by skilled chefs in Premium Pubs . What we offer our Head Chefs: • Head Chefs get to have full autonomy to create your own menus and specials, • Access to our Apprenticeship Scheme and Development Programmes, • Access to regular culinary masterclasses covering topics such as Game, Butchery and Shellfish, • Access to inspirational food trips with our top quality suppliers, • Regular Chef Forums with other Head Chefs to inspire and develop, • Free meals, • 20% discount in all Young's Pubs and 30% discount on overnight stays in our Pubs with Rooms, • Share save Scheme, • Enhanced Company Pension Scheme, • 28 Days Holiday per year What we look for in a Head Chef: This role requires someone that can inspire a team, to bring out the potential and lead by example whilst being able to develop, cost and produce fresh seasonal menus for the variety of revenue streams within the business. • Have experience championing excellent service through quality food either as a Head Chef or in the position of Sous Chef, • Demonstrate a passion for leading and developing a team, • Be an active hands-on team player with excellent communication skills, • Be responsible and able to manage the kitchen staff rota, training and all health and safety effectively at all times, • Be able to demonstrate your creativity and ability to design and deliver new dishes for our menus and daily specials, • Demonstrate great planning and organisational skills, necessary to maintain effective controls with regard to both GP and labour, • Have a pro-active approach to driving sales and delivering growth, through engagement with both kitchen and front of house teams

Job Advert Ward Sister North Downs Hospital Part time - 37.5 hours per week North Downs Hospital is one of Surrey's leading private hospitals with an excellent reputation for delivering high quality healthcare treatments and services. Located within the M25, close to the centre of Caterham, the hospital opened in 1974 and currently has 15 bedrooms, all with en-suite facilities and a daycase suite. By investing in advanced medical technology, the hospital offers a wide range of treatments and services. The fully equipped ultra clean air theatre is particularly suitable for orthopaedic procedures offered such as arthroscopy, hip and knee replacements. The day unit is suitable for minor operations and endoscopy. Treatments at the hospital also include cataract removal, ENT procedures, hernia repair, varicose vein surgery, hysterectomy, prostate surgery and urological procedures. A fantastic opportunity has arisen for an enthusiastic and highly motivated Ward Sister / Charge Nurse to join the ward nursing team at North Downs Hospital. You will be expected to help lead our team, supporting junior members of the team and coordinating the ward. The role In this role you will be an integral part of a team who are committed to delivering the highest quality clinical outcomes in a supported environment, where you will be valued for your skills and expertise. The appointed Ward Sister / Charge Nurse must be organised with good attention to detail, excellent communication skills and the ability to work well within a team. The successful candidate will support the Ward Manager and team in ensuring that safe, effective and high quality clinical care is delivered to all patients. What you will bring with you Current NMC registration An ability to deliver high standards of patient care Mentorship qualification desirable Previous Clinical Supervisory and Mentorship experience Enthusiastic and empathetic character promoting positive attitude at work Experience with EPR (Electronic Patient Records) system Flexibility and adaptability to meet the changing needs of the business Deliver a good working knowledge & compliance with CQC Standards /KLOEs and NICE guidance Be part of the On-Call rota providing support for ward out of hours Why join us? At Ramsay Health Care UK, our people are at the heart of our success. Our benefits are designed to support your wellbeing, work-life balance and career development, because we’re people caring for people: Health, Wellbeing & Financial Security • Private Medical Cover, with the option to add your partner and dependants, • Discounted Bupa Dental Insurance, • Life Assurance (Death in Service) x3 your base salary, • Private Pension, with Ramsay matching up to 5% after a qualifying period, • Employee Assistance Programme Work–Life Balance • 25 days annual leave + bank holidays, with the option to buy or sell additional days, • Flexible shift patterns, where possible, • Family friendly policies including enhanced parental leave, • Volunteer leave to support causes that matter to you Career Development & Recognition • Training and Development via the Ramsay Academy to support your career development, • Colleague recognition programme to celebrate our people Lifestyle & Everyday Perks • Access to our benefits platform, offering a wide range of discounts, • Cycle2Work scheme, • Subsidised staff restaurant, where possible, • Free parking on site, where possible About us Ramsay Health Care UK is a well-established global hospital group with over 60 years’ experience. We are a global provider operating in 11 countries with 77,000 staff who treat 8 million patients each year. It is well respected within the healthcare industry and is one of the leading providers of independent hospital services in England. We are well known for our strong, long-standing relationship with the NHS. We love people with a positive, “can do” attitude who want to make a difference in their work. "Our employees are Ramsay." The skills and commitment of our employees forms the basis for our success. We know our people are our greatest asset, our business is growing and we would like you to join us. “The Ramsay Way” culture recognises that people – staff and doctors – are Ramsay Health Care’s most important asset and this has been key to our ongoing success. We are proud of our ‘Speak Up for Safety’ programme and ensure that the patient is at the heart of everything we do. Join us and have more ‘Time to Care’. We care. It’s more than what we do, it’s who we are. Everything we do is about striving to deliver the best care. And it's a belief that's as true today as it was when we welcomed our first patients in 1964. “The Ramsay Way” culture recognises that our people are our most important asset and this has been key to our ongoing success. We are committed to equality of opportunity for all. This position is subject to background and DBS checks. We are proud to support the UK’s Armed Forces and Reservists and have already achieved the Silver Award as part of the MOD’s Armed Forces Covenant Employer Recognition Scheme. The scheme recognises employers who actively support Defence while encouraging other organisations to adopt the same behaviours in their workplace. As a company we are committed to supporting the wider Armed Forces community and this includes our staff as well as our patients. We are committed to safeguarding and promoting the welfare of adults, children and young people at risk. We expect all employees to share this commitment and behave in a way that supports it. All successful candidates will be provided with safeguarding training appropriate to their role.

We are Hestia. We make a difference. \n At Hestia, we are guided by our core values and are dedicated to fostering an equitable, diverse, and inclusive organisation. Our mission is to empower individuals to rebuild their lives and achieve independence. Right now, we are looking for a Tutor & Activities Coordinator to play a pivotal role in our Age Activity Service in Wandsworth. \n Sounds great, what will I be doing? \n Hestia's Age Activity Centre (AAC) is a lively, open‑access day centre supporting Wandsworth residents aged 60 and over to stay active, independent and socially connected. The service offers a wide range of activities including IT classes, wellbeing sessions, social events and occasional day trips, all designed to reduce isolation, promote community, and help older people maintain their health and independence for as long as possible. Alongside this, the AAC plays a key role in fostering friendships, building confidence and creating a welcoming space where older people can thrive. \n This role supports both the AAC and the Hestia Recovery Café, contributing to the smooth running of daily learning and development activities. It involves leading and overseeing adult learning classes, supporting volunteer and pool worker recruitment, and managing essential resources and administrative tasks. The postholder will help ensure high‑quality, engaging sessions while maintaining an organised, inclusive environment that empowers older people and enhances their overall wellbeing. \n The hours are 9am - 5.18pm Monday, Tuesday, Wednesday, Friday and 12pm - 8.18pm on Thursday. \n What do I need to bring with me? \n You'll need to be able to demonstrate the core skills this role requires as well as match our values and mission. You don't have to tick all the boxes right away; the important thing is that you're willing to learn. We also value lived experience of the areas we support, so if you feel comfortable, please do mention this on your application. \n You have experience supporting people with mental health needs and complex circumstances, as well as working with older adults, senior adults or other vulnerable groups. You understand how to identify and report safeguarding concerns, recognise signs and symptoms of mental health issues, and respond appropriately within professional boundaries. You are confident facilitating learning and development activities, group work or support groups, and you are able to engage with individuals who may display a range of emotions or behaviours that can sometimes feel challenging. \n You communicate clearly and professionally, both verbally and in writing, and you can accurately receive, process and record detailed information while maintaining confidentiality. You are IT‑literate, comfortable using Microsoft Office and able to learn new systems or apps. You bring strong time‑management skills, attention to detail, and the ability to work both independently and as part of a team. You liaise confidently with colleagues and external partners, represent Hestia positively, take a solution‑focused approach to problem‑solving, and can identify and report any health and safety concerns within a day‑centre environment. \n Interview Steps \n We keep our interview process simple, so you know exactly what to expect. \n\n • Shortlisting call: We have a team of dedicated recruitment specialists who will speak to you about your experience, motivations and values. They will also tell you about all the great work we do!\n, • Face to face interview: Now you will have face to face interview with the hiring manager. Our interviews are value and competency based.\n\n Don't be alarmed if there are other stages in the process, it's all part of the plan for some of our roles. \n Our commitment to Equality, Diversity, and Inclusion \n Our services users come from all walks of life and so do we. We hire great people from a wide variety of backgrounds because it makes us stronger. We are committed to creating and maintaining a diverse and inclusive workforce and value the skills, abilities, talent and experiences, different people and communities bring to our organisation. \n We are a disability confident employer \n Hestia is proud to be a disability confident employer, dedicated to the employment and career development of individuals with disabilities. We offer a guaranteed interview scheme for all applicants with disabilities who meet the minimum criteria for the role they have applied for. We also provide reasonable adjustments during the selection and interview process, and throughout your employment with us. \n Safeguarding Statement \n Hestia is committed to safeguarding and promoting the welfare of adults, children and young people who are potentially at risk, and we therefore expect all staff and volunteers to do the same. We require all staff to undertake internal and external safeguarding training throughout their employment with Hestia. \n Important Information for Candidates \n If your application is successful, please be aware that you will be required to undergo pre-employment checks before a formal offer of employment can be confirmed. \n We reserve the right to close this job advert early should we receive a high volume of applications or if the position is filled before the closing date. We encourage interested candidates to apply as soon as possible to ensure their application is considered. \n

About the Company We are currently recruiting for a Digicon Finishing Operator to join a well-established label manufacturing business. This role is ideal for somebody with experience operating label finishing, converting, or print production machinery within a manufacturing environment. About the Role You will be responsible for operating and maintaining Digicon label finishing equipment, converting digitally printed label rolls into finished products. The position involves setting up finishing processes, ensuring quality standards are maintained, monitoring production output, and working efficiently to production schedules within a fast-paced manufacturing environment. Responsibilities Operate and set up Digicon finishing machinery Prepare printed label rolls for finishing operations Install and align rotary dies, varnish units and finishing tooling Adjust machine settings to ensure accurate registration, tension and cutting quality Monitor production runs to maintain quality and consistency Inspect finished labels and identify any defects or quality issues Carry out routine machine maintenance, cleaning and basic troubleshooting Maintain production records and job documentation Work to production schedules and customer deadlines Follow all health and safety procedures within the manufacturing environment Qualifications Print production, label converting or manufacturing-related training advantageous Experience operating finishing or converting machinery preferred Health & Safety awareness preferred Required Skills Experience operating label finishing, converting or print production equipment Knowledge of die-cutting, laminating, foiling, varnishing and slitting processes Ability to read and interpret job specifications and production documentation Strong attention to detail and commitment to quality control Mechanical aptitude and problem-solving ability Ability to work efficiently within deadline-driven production environments Good communication and teamwork skills Understanding of manufacturing health and safety procedures Pay Range and Compensation Package Salary: £29,000 – £32,000 per annum, depending on experience. Benefits Company pension Cycle to Work scheme Life insurance Free on-site parking Working Hours Rotating Double Day Shift Pattern (Monday–Friday) Week 1: 05:50 – 13:25 Week 2: 13:25 – 21:00 Friday shifts are shortened: Morning Shift: 06:00 – 12:00 Afternoon Shift: 12:00 – 18:00

Theratewillrangefrom£390LtdforthoseundertakingtheirL6CIOBcourseand£500Ltdforsomeonewithitandheavilyexperienced.AstrongworkingknowledgeoftheBuildingSafetyAct2022,FireSafetyAct2021andtheRegulatoryReform(FireSafety)Order2005,withtheabilitytoapplythesewithinasocialhousingcontext.Anunderstandingofbuildingsafetycaseprinciples,buildingcontrolprocessesandresidentengagementrequirements,alongsidetheroleoftheBuildingSafetyRegulatorandlocalauthoritygovernanceframeworks.Atleastthreeyearsrelevantexperience,havingdevelopedandmanagedBuildingSafety.Itisessentialthatcandidateshavethebelowotherwisetheywillberejected.AstrongworkingknowledgeoftheBuildingSafetyAct2022,FireSafetyAct2021andtheRegulatoryReform(FireSafety)Order2005,withtheabilitytoapplythesewithinasocialhousingcontext.Anunderstandingofbuildingsafetycaseprinciples,buildingcontrolprocessesandresidentengagementrequirements,alongsidetheroleoftheBuildingSafetyRegulatorandlocalauthoritygovernanceframeworks.Atleastthreeyearsrelevantexperience,havingdevelopedandmanagedBuildingSafetyCaseReports,coordinatedmulti-disciplinaryteamsandsupportedcontinuoussafetyimprovements.Confidentwithengagingwithresidentsandstakeholders,mentoringoperationalteamsandcontributingtoapositivecomplianceculture.ACIOBLevel6DiplomainBuildingSafetyManagement(orworkingtowards),supportedbyongoingprofessionaldevelopmentandeligibilityforrelevantprofessionalmemberships,isexpected.LambethCouncilownsandmanagesasignificantportfolioofsocialhousing,includinghigher-riskresidentialbuildings(HRB).Ensuringthatresidentsaresafeandfeelsafeintheirhomesisatoppriority.ThecounciliscommittedtomeetingitsobligationsundertheBuildingSafetyAct2022,theFireSafetyAct2021andtheRegulatoryReform(FireSafety)Order2005tohelpdeliversafe,well-managedhomesthatcomplywithallstatutoryrequirements.TheFire&BuildingSafetyteamleadsonensuringrobustsafetymanagementsystemsacrossthehousingstock,fosteringacultureofaccountability,residentengagementandcontinuousimprovementinbuildingsafetystandards.JobPurposeToprovideprofessionalleadershipandassuranceinthemanagementofbuildingsafetyforLambethCouncilsHRBs.Thepostholderwillensurefullcompliancewithrelevantlegislation,includingtheBuildingSafetyAct2022,theFireSafetyAct2021andtheRegulatoryReform(FireSafety)Order2005,alongwithassociatedstatutoryguidance.Theywilldevelop,maintainandmonitorBuildingSafetyCasesandBuildingSafetyCaseReports,coordinateresidentengagementonsafetymattersandactasakeypointofcontactbetweeninternaldepartments,residentsandexternalregulators.TheBuildingSafetyManagerwillworkcollaborativelyacrosstheorganisationtoembedaproactivecultureofsafety,transparencyandcontinuousimprovement,ensuringthatallbuildingsundertheiroversightremainsafeforoccupation.Responsibilities-LeadtheoperationalmanagementofbuildingsafetyfordesignatedHRBswithinthecouncilshousingstock.-OverseecompliancewiththeBuildingSafetyAct2022,FireSafetyAct2021,theRegulatoryReform(FireSafety)Order2005andthe FireSafety(ResidentialEvacuationPlans)(England)Regulations2025, ensuringthatstatutorydutiesarefullydischarged.-Build,maintainandreviewBuildingSafetyCasesandBuildingSafetyCaseReports,ensuringaccuratedocumentation,up-to-daterecordsandevidenceofeffectivecontrolmeasures.-Undertakeandcoordinateregularbuildinginspections,reviews,assessmentsandauditsrelatingtostructuralandfire&buildingsafety.KeyKnowledgeComprehensiveunderstandingoftheBuildingSafetyAct2022,FireSafetyAct2021,andtheRegulatoryReform(FireSafety)Order2005,andtheirapplicationinsocialhousing.Knowledgeofsafetycaseprinciples,buildingcontrolprocessesandhousinghealthandsafetycompliance.StrongunderstandingofresidentengagementrequirementsandtheroleoftheBuildingSafetyRegulator.Awarenessoflocalauthoritygovernance,socialhousingmanagementandregulatoryframeworks.RelevantExperienceProvenexperience(minimum3years)infireandbuildingsafety,housingcomplianceorarelatedfield.Experienceofdeveloping,managingandreviewingBuildingSafetyCaseReportsandothercompliancedocumentation.Demonstrateabilitytocoordinatemulti-disciplinaryteamsanddrivesafetyimprovements.Experienceofengagingwithresidentsandstakeholdersonsafetyandcompliancematters.Experienceofmentoringorsupportingoperationalhousingteamsincomplianceorsafetymanagement.Qualifications-CIOBLevel6DiplomainBuildingSafetyManagement(orworkingtowards).-Health&Safety-Evidenceofcontinuedprofessionaldevelopmentinfireandbuildingsafetymanagement.ProfessionalMembershipsMembership(oreligibilityformembership)ofoneormoreofthefollowingprofessionalbodiesisdesirable:-InstituteofBuilding(CIOB)-InstitutionofOccupationalSafetyandHealth(IOSH)-InstitutionofFireEngineers(IFE)-InstituteofFireSafetyManagers(IFSM)-RoyalInstitutionofCharteredSurveyors(RICS)-Orotherrelevantprofessionalorganisationsassociatedwithbuilding,fire,orsafetymanagement.TPBN1_UKTJ

Part Time Fire Alarm TesterLocation : Kingston, KT1 2EESalary : £17,131.30 per annum (pay review August 2026)Contract : Part Time, Permanent (22.2 hours per week)Working Pattern : 3 days per week - Tuesday, Wednesday, plus 1 flexible dayJoin a Role That Plays a Vital Part in Site SafetyKUSCO (Kingston University Service Company Ltd) is a wholly owned subsidiary of Kingston University, providing facilities management services across the University estate.We are now looking for a reliable, self-motivated Fire Alarm Tester to join our Estates and Asset Department.This is a crucial role responsible for ensuring fire safety systems across multiple University sites are tested, maintained and compliant, helping to keep staff, students and visitors safe every day.About the Fire Alarm Tester RoleWorking across four campus sites, halls of residence and additional buildings within the local area, you will carry out a structured programme of fire safety testing and checks.You'll be responsible for testing over 50 fire alarm systems weekly, along with other fire protection systems, and completing routine fire door inspections.This is a practical, site-based role that requires attention to detail, good organisation, and the ability to work independently.What You'll Be DoingCarrying out weekly fire alarm testing across all University buildings in line with British Standard 5839-1 and internal proceduresCompleting 6-monthly fire door inspections in line with set schedulesRecording all testing, checks and observations accurately in fire safety logbooks and electronic systems (e.g. Nimbus)Reporting faults, defects or issues immediately via mobile systems or the FM HelpdeskMonitoring fire safety risks (e.g. blocked exits, combustible materials), recording and reporting findingsCoordinating activities with fire wardens, security, maintenance teams and contractorsSupporting fire drills, panel activations, fire risk assessments and auditsAssisting with fire marshal training when requiredContributing to ongoing fire safety improvements across the estateTesting and checking associated systems including:Smoke ventilation systemsFire curtainsRefuge call pointsAutomatic door closers and door release mechanismsIn order to be successful in this role you must have:Full UK driving licence and access to your own vehicle (mileage reimbursed)Strong timekeeping and ability to follow structured schedulesAble to work independently and solve problems with minimal supervisionExcellent attention to detail and ability to follow procedures accuratelyGood communication skills (written and verbal)Strong record-keeping and administrative abilityBasic understanding of Health & Safety requirementsBasic IT skills and confidence using mobile devices / tabletsGood level of physical fitness (role involves being on your feet most of the day)It would be great if you had:Experience with fire alarm systems or similar technical systemsKnowledge of fire safety procedures, British Standards or electrical systemsExperience using Nimbus or similar electronic log systemsPrevious fire marshal training or fire safety responsibilitiesPractical, hands-on technical skills and basic fault findingWhy Join KUSCOBe part of a trusted organisation supporting Kingston UniversityPlay a key role in maintaining safety across a large estateStructured, independent role with clear responsibilitiesFull training provided on systems and proceduresSupportive team environment within Estates & AssetsOpportunity to develop technical knowledge and experienceThis role is critical to ensuring compliance with fire safety legislation and protecting the University community.If you are dependable, detail-focused and take pride in doing work properly, we would love to hear from you.Apply now!No agencies please.TPBN1_UKTJ

Who We Are Hatching Dragons is not a basic nursery group. We are early years development specialists, and the distinction matters enormously. We have built everything — our environments, our curriculum, our family partnerships, our daily rhythms — around a single truth: the developmental window between birth and five is the most significant period of neurological, emotional, and cognitive growth a human being will ever experience. We do not waste a moment of it. Our Development Framework together with a '3C curriculum' — Culture, Character, Cognition — runs through everything we do. It is not a programme, it is a philosophy, made operational in every observation, every Circle Time, every World Food Day, every interaction between a practitioner and a child. We deliver structured multilingual education throughout the day. We have a commercially qualified head chef preparing fresh, nutritionally balanced food for every setting. We have strong research links with UCL’s Institute of Education and Cambridge University’s Child Development and Psychology departments, and emerging relationships with the Anna Freud Centre for a clinically grounded mental health programme for our staff, children, and families. We are a business preparing for significant growth. New settings. New services. National and international expansion. The infrastructure is being built. A fresh rebrand is now ready to carry it, and we are building the leadership team that will take it there. The Opportunity Our Westminster nursery (located in Pimlico) has just completed a significant refurbishment and is preparing to double in capacity from September 2026. This is not a steady-state management role. This is a building role for a leader who wants to shape something, not just run something. You will join a group nursery leadership team that is readying for national and international expansion, have direct line into the Managing Director and will be part of the conversations that shape where this organisation goes next. The Westminster setting is your primary responsibility, but the ambition this role sits within is much larger. The Role — What You Will Actually Do This is a full-scope nursery management role with genuine leadership responsibility. You are not the most senior person in a room, you are the leader of a setting. The following is what that means in practice here. Leadership & Culture • Lead, coach, and inspire a growing team of practitioners, room leaders, and apprentices across all rooms, • Build and maintain the kind of team culture that makes people stay, grow, and deliver their best work, • Model the Hatching Dragons values — the 3Cs, the commitment to development, the warmth and the rigour — in everything you do, • Hold your team to high standards, with the coaching and support to meet it, • Be a visible, energetic, trusted presence in the setting every day Educational Quality & Curriculum • Take ownership of the delivery of the Hatching Dragons 3C curriculum and Child Development Framework across all rooms, • Drive outstanding EYFS practice — with the sights set firmly on operating at exceptional Ofsted standards, • Ensure every child is observed, known, and supported against their developmental milestones, • Oversee the Development Support Plan framework — ensuring every child who needs additional focus is identified and supported proactively, • Lead the multilingual and World Food Day programme delivery with excellence and consistency Operations & Compliance • Manage the day-to-day operational running of the setting — including staffing, ratios, rotas, and resource management, • An opportunity to run the nursery as a business, as a company director, with P&L ownership, • Ensure full EYFS statutory compliance across safeguarding, welfare, health and safety, and all regulatory requirements, • Maintain inspection readiness at all times — the standard that is lived daily, not prepared for occasionally, • Oversee accurate and timely record-keeping, reporting, and documentation across all rooms, • Manage relationships with external agencies, local authority, health visitors, and SEND specialists Family Partnership & Community • Build and maintain exceptional family relationships — treating every parent as a partner in their child's development, not a customer to be managed, • Lead on settling-in, progress meetings, DSP conversations, and room transition communications, • Represent Hatching Dragons to prospective families — conducting tours, converting enquiries, and building the Westminster community, • Be the visible face of Hatching Dragons Westminster in the local community and among existing families Commercial & Growth • Take ownership of occupancy targets and contribute actively to growing the Westminster setting to full capacity, • Lead the nursery sales programme, engaging across the local community to attract potential new parents into the nursery, • Work with the central leadership team on marketing, recruitment, and parent engagement initiatives, • Input into the wider group strategy — sharing intelligence from the setting that informs how we grow Salary & Package £45k - £55k dependant on experience - Performance-related bonuses - Employee benefits platform (virtual GP, EAP counselling, 9,000+ discounts) - Personal L&D budget - Un-capped commission opportunities with every family you bring in About You We aren't looking for JUST a qualified nursery manager, but a leader who is genuinely excited by what we are building and has the capability to help us build it too. You have the foundations • Level 3 Early Years qualification or above (EYFS-approved), • At least one full nursery management role — you have run a setting before, • Strong working knowledge of the EYFS, Ofsted inspection framework and statutory safeguarding requirements, • Experience managing and developing a team of practitioners across multiple rooms, • A track record of building genuine family partnerships, not just communicating with parents, but partnering with them You have the right energy • High energy, high standards, and genuinely ambitious — for the children in your care, for your team, and for the organisation, • Entrepreneurial in mindset — you see what could be, not just what is. You build things rather than maintain them, • A natural coach — you develop people, you do not just direct them, • Calm under pressure and decisive when it counts, • Deeply committed to early years development as a specialism — not just as a job You will thrive here if • You want to be part of building something, not just running something, • You are energised by growth and comfortable with the pace and ambiguity that comes with it, • You believe in our 3Cs — that culture, character, and cognition are the real curriculum, • You hold yourself to the same standard you hold your team, • You want your work to matter — and you are willing to do what it takes to make it Why Join Hatching Dragons? You are joining at the right moment Westminster has just been refurbished. The brand has just launched. The curriculum framework is ready. The team is growing. Over 80 children arrive in September. This is the moment — and you would be stepping into it as the leader who makes it happen. You are joining a group, not just a nursery This is a group nursery leadership role with a single-setting focus. You will be part of a leadership team that includes Nursery Managers across our London settings, the central support team, continuous improvement consultants, and the Managing Director. The conversations you will be part of go well beyond Westminster. You are joining an organisation that invests in its people Every Hatching Dragons team member has a personal L&D budget. Access to a virtual GP and BACP-accredited counselling through our Perkbox partnership. A salary sacrifice scheme through Ezoo. A structured early years mental health programme developed with UCL and the Anna Freud Centre. Commission opportunities for bringing in new families. And a leadership team that is genuinely committed to making this a great place to work — not just in what it says, but in what it does. You are joining at the start of something national Hatching Dragons is preparing for significant expansion — new settings, new cities, new services, and new business models. The leaders who join us now are the leaders who will shape where we go. Safeguarding Statement Hatching Dragons is committed to safeguarding and promoting the welfare of children and expects all staff and volunteers to share this commitment. This role is subject to an enhanced DBS disclosure, satisfactory references and all other pre-employment checks required under the EYFS Statutory Framework and Keeping Children Safe in Education (KCSiE). What Success Looks Like — Your First 3–6 Months Month 1 — Know the setting. Know the team. Know the families Immerse yourself. Spend time in every room, with every practitioner, and with as many families as possible. By the end of month one you will have a clear picture of where the setting is — and a plan for where it needs to go. Months 1–3 — Embed the curriculum. Raise the standard The Hatching Dragons 3C curriculum, Teaching & Learning Master Framework & Child Development Frameworks are ready. Your job is to bring them to life consistently across every room — building the coaching culture that makes high standards stick and establishing yourself as a visible, trusted leader from day one. Months 2–4 — Prepare for Ofsted An inspection is expected. We aim for Outstanding — and that ambition needs to be present in every room, every day. Self-evaluation honest and evidenced. The team able to articulate intent, implementation and impact with confidence. Safeguarding airtight. Months 2–6 — Build the team Westminster grows to 82 children from September. Getting the right people into the right roles — inducted, supported, and developing — is one of your most important early priorities. The team you build now defines what this setting looks like for years to come. Months 3–6 — Drive occupancy Work with the central team to grow occupancy towards September targets. Convert tours. Make current families advocates.

Please only apply for this role if you hold a full Driving Licence, CPC and Digi Card.We are currently recruiting for a reliable and professional 7.5T Driver to join our client's team based in Croydon.The rate of pay is £33,737 per annum, plus bonus.This is a full-time role working fixed shifts and the hours of work are:- 6:45am to 4:15pmYour Time at WorkAs a 7.5T Driver, you will play a key role in ensuring timely and safe deliveries to our customers, while representing our company to a high standard.Key Responsibilities:- Driving a 7.5-tonne vehicle to deliver goods across regional routes- Loading and unloading goods safely- Ensuring all deliveries are completed on time and in full- Completing delivery paperwork and using handheld scanners- Performing daily vehicle checks and reporting any defects- Maintaining compliance with health & safety and driving regulations- Providing excellent customer service on deliveryOur Perfect WorkerRequirements:- Valid UK Category C1 (7.5T) driving licence- Driver CPC qualification and Digi Tacho card- No more than 6 penalty points (no DR, DD or IN convictions)- Physically fit - some manual handling will be required- Good communication and time management skills- Previous 7.5T driving experience essential- Knowledge of the local areaKey Information and Benefits- Earn £33,737 per annum- Full-time- Free car parking on site- Uniform provided- Attendance bonus- Full training providedJob Ref: 1BUNZLHCAbout StafflineStaffline is the UK's largest recruitment solutions partner, enabling over 35,000 people into good work every week. We operate at more than 420 customer sites across England, Scotland and Wales.As one of the most established recruitment agencies in Nottingham with operations across the UK, we specialise in connecting businesses with temporary and permanent jobs across warehouse & logistics, food and drink, aviation, driving, technical & engineering, manufacturing & automotive and security.Important Information- Staffline and its subsidiaries do not charge any recruitment or job-seeking fees at any stage of the hiring process.- This job advert may not be copied, imitated, or used, in whole or in part, by third-party websites, without prior written consent from Staffline.- Our job adverts are correct at the time of publication, but some details and job responsibilities are subject to change.TPBN1_UKTJ

Mechanical Engineer (Level 3) Location: HMP Wandsworth (SW18) Salary: £43,177.30 per annum + an additional 5% salary in recognition of shift and weekend working Contract: Permanent, 39 hours per week We are seeking a NVQ Level 3 qualified Plumber to join our team at a HMP Wandsworth, a category B adult male prison as a Mechanical Engineer. Join a team that is more than just a group of colleagues - we work Monday to Sunday as a supportive and driven family, working together to create a safe and nurturing environment. HMP Wandsworth runs like a self-contained city, it takes hundreds of people to keep it functioning, and as the Facilities Maintenance Team we are committed and driving the smooth and safe operation, like a heart that pumps blood through the body, everything we do impacts every prisoner, employee, and visitor, and wider to the families and community. As a Mechanical Engineer you will have the opportunity to work alongside experienced and passionate colleagues who vary from Plumbers, Electricians, Carpenters, Painters, to Cleaners, and Administrators, and others, who are all dedicated to making a positive difference, providing a safe and secure environment for all. If you are looking for a role where you can use your skills to create a better future for others, we encourage you to apply for this compelling opportunity and join us in our mission to promote rehabilitation and positive change and be part of a team that truly makes a difference. We are a Ministry of Justice business and provide critical and time-bound services to HMPPS, and are looking for a Plumber to join us as a Mechanical Engineer with one of the following NVQ Level 3 qualifications and combination of skills: C&G 6189 Plumbing and domestic heating C&G 5962 certificate in Plumbing (Advanced craft) C&G 6019 Mechanical Engineering services (plumbing) C&G 6018 heating and ventilation installation C&G 6129 certificate in Plumbing C&G 214 Engineering systems maintenance C&G 6188 Heating and ventilating C&G 6088 certificate in heating and ventilating C&G 6032 the advanced craft certificate in plumbing EAL Diploma in Plumbing and Heating Experience working on commercial or industrial heating, water or building service systems. Unvented water heater vessel course G3 - Highly desirable Two years' experience working in a role as a plumber or equivalent Be familiar with and able to work to Water supply regulation and Control of Legionella L8 requirements Good working knowledge of planned preventive maintenance operations Good working knowledge of relevant health and safety requirements L8 awareness training - Desirable (Provided if required) If this sounds like you, we would like to hear from you! Explore a varied and rewarding career at GFSL. Welcome to careers at Gov Facilities Services Limited (GFSL). Joining us is your chance to help ensure prisons are secure and safe for prisoners and prison staff alike, and to play your part in helping prisoners reintegrate into society. Holidays are 25 days per year plus Bank Holidays, and a range of non-contractual benefits are provided. These range from Death in Service at 4x salary, to access to private GP consultations and an Employee Assistance Programme that offers counselling and information services for preventative care and to help employees in a crisis. There are also a range of financial reward mechanisms and access to retailer discounts. You will find a strong focus on safety, a supportive, inclusive workplace, a competitive benefits package, and real opportunity to build your skills and progress. Explore facilities careers where you can make difference. Pride In People. We're passionate about promoting greater diversity and creating a workplace and culture where all of our employees have a voice that is heard, feel a sense of belonging and are empowered to be their true selves. We recognise the value that every single employee brings to the organisation. Everyone's needs at work are different and we are committed to doing our best to satisfy these differences whilst ensuring consistency and fairness for all. We promise to champion diversity and inclusion with ongoing learning and training, as well as career progression opportunities for everyone. Future Plans. GFSL has been notified by it's shareholder (MOJ) that the provision of FM Services will in future be delivered by the private sector. This means that following a successful procurement process, GFSL's services will complete transfer to a private sector provider/providers no sooner than August 2027. Pride in People - Do the Right thing - One Team An ISO 9001 Certified Company TPBN1_UKTJ

Right across infrastructure, theres a requirement to not only maintain, but also renew and reimagine. Whatever stage youre at in your career, with us youll have an opportunity to grow and develop. Delivering essential infrastructure services for life, while being safety first, and client and customer centric in a friendly, fun and respectful environment where you are encouraged to thrive.Where will you be working?At M Group Energy, were enabling the energy essential to support our lives.We provide an end-to-end service, delivering solutions in electricity transmission, distribution, renewable energy, EV, metering and home decarbonisation.This role will be within our Metering team , youll join the leading provider of metering services in the UK energy retail sector, we provide efficient and flexible services for gas, electricity and water meters. Want to come and be a part of it?We are recruiting in postcodes; BR, CR, SM, TW, KT, GU, RHWhat will you be doing?As an engineer, you will form part of our Metering team that provides a wide range of services from Smart installations, Investigating non-communicating smart meters, emergency and maintenance appointments. Do you enjoy working on your own, chatting to customers and meeting new people?Customer service is our top priority. You'll make sure that all jobs are completed on time and our customers are provided In-depth explanations of the benefits and safe usage of their new meter. Youll also be responding to emergencies, restoring power or gas when customers need it the most. Do you like meeting new people, and helping make a difference to their lives?You'll also be provided with continuous training to maintain and develop your skills. Do you want to know a fun fact? 87% of our field management team have been internally promoted. Are you looking for longevity in your career? You can have it with M Group Energy.You'll have health and safety at the heart of everything you do! Do you want extra training to make sure your knowledge is up to scratch and enhance your skills in the industry? Your onboarding journey will make sure you are prepped and ready to be an ambassador for health and safety!Worried the role could be lonely? You'll be on weekly meetings, catch ups and our field managers and support functions are always there to come out and offer a helping hand or assistance. No day is the same, and you'll be given endless opportunities to shine.What youll bring Valid UK driving licenceYou must have held your licence for 1 year and have less than 6 points.Do you have a CCN1 / CMA1 / CMA3, or hold an NVQ Level 2 in Smart Metering Dual Fuel? Are you experienced installing gas and electric smart meters?Have you got previous MOCOPA experience?If you have the below qualifications and skills, great, but you dont need them to apply; REGT1, 3 phase, CTWhats in it for you?Salary: Dual Fuel - £39,033Dual Fuel (3 phase/CT) - £40,117Dual Fuel - £42,285 (if based inside the M25)Dual Fuel (3 phase/CT) - £43,370 (if based inside the M25)£2k attendance and safety bonus per annum for full time rolesWe offer a range of benefits designed to support your life in and out of work, some of which include; Matched or contributory pension schemeOnline GP service, 24 hours a day, 365 days a yearEmployee assistance programmeMy Rewards portal, access to 1000s of retail discountsLife assuranceCycle to work, salary finance and give as you earn schemesEnhanced maternity, paternity leave and adoption leaveReward and recognition schemeIn addition, this role offers; £2000 per year safety and attendance bonus split payment every 6 monthsOn target earnings of up to £50k+30-33 days (including bank holiday)Sick pay SchemeYou'll have access to an uncapped additional productivity related bonusAre you 3phase/CT and/or Medium Pressure qualified? That'll be £1000 added to your salary!Regular overtime paid is available to you at time and a half and double time on SundaysLooking for progression? 87% of our field managers have been promoted from DF engineersCompany van/vehicle and fuel card for business usePrivate health care and health care cash plan for youRecommend a friend get rewarded for introducing people to us!Standby / Overtime / Call out - Extra earning potential.About usWe want to be an employer of choice and a great place to work, attracting diverse and talented people, who join us and make a difference. We are one of the Top 100 UK companies actively supporting and recruiting veterans. Our ENABLE inclusion networks bring together people who have a shared passion, to help create an environment where everyone belongs.Our values help to shape our culture and how we work with one another. We recruit with these values in mind, to ensure your aspirations, and ways of working, align with ours. Were responsible and go further for our people, clients, communities and the planetWere open and seek new and better ways of exceeding expectationsWere together and as one team; the whole is greater than the sum of the partsWere ambitious and embrace opportunity, to lead essential infrastructure services for lifeWhether youre a trainee, apprentice or graduate, or progressing through your career, our people benefit from industry recognised programmes, training and development.Its an exceptional time to be a part of M Group.Please note: Occasionally, job adverts might be closed before the stated closing date. Do apply as soon as possible to ensure your application is considered.For certain roles, successful candidates will be subject to 3rd party background checks as part of the hiring process. Some roles require drug and alcohol testing as part of induction and onboarding.#MGroupE INDREGTPBN1_UKTJ

Location Beckenham Hours 08.00-16.30 or 09.00-17.30 plus overtime Pay: £45,000.00-£50,000.00 per year plus overtime OVERVIEW Eclipse is seeking an experienced and highly capable Scenic Workshop Manager to lead the delivery of high-quality scenic builds for a wide range of live events, productions, and experiential projects. This is a senior role requiring both exceptional technical expertise and strong leadership capability. The successful candidate will be responsible for managing a large, multi-disciplinary workshop team, ensuring projects are delivered safely, on time, within budget, and to the highest creative and construction standards. Working in a fast-paced and high-pressure environment, the Scenic Workshop Manager will play a critical role in translating creative concepts into practical, buildable solutions while maintaining operational efficiency and a positive team culture. MAIN DUTIES & RESPONSIBILITIES Workshop Leadership & Management • Lead, manage, and develop a large scenic workshop team, including carpenters, metalworkers, scenic artists, and freelancers, • Plan and allocate resources effectively across multiple concurrent projects, • Foster a collaborative, high-performing, and safety-first working environment, • Conduct performance management, training, and mentoring of staff Project Delivery • Oversee the construction of scenic elements from concept through to completion, • Interpret technical drawings and ensure accurate and efficient builds, • Work closely with designers, production managers, and clients to realise creative intent, • Ensure all projects are delivered on time, within budget, and to Eclipse’s quality standard Operational Management • Manage workshop scheduling, workflows, and capacity planning, • Monitor and control project budgets, materials, and labour costs, • Identify and implement process improvements to enhance efficiency and output, • Oversee procurement of materials and equipment as required Health & Safety • Ensure full compliance with all relevant UK Health & Safety legislation, • Maintain safe systems of work, risk assessments, and method statements (RAMS), • Promote a proactive safety culture within the workshop, • Ensure all staff are appropriately trained in safe use of tools and machinery Technical Oversight • Provide expert guidance on scenic construction methods, materials, and finishes, • Troubleshoot technical challenges and develop practical solutions, • Oversee maintenance and safe operation of workshop tools and equipment Stakeholder Communication • Act as a key point of contact between the workshop and wider production teams, • Communicate progress, challenges, and solutions clearly to stakeholders, • Support client-facing discussions where required WORKING HOURS There is a requirement for the Scenic Workshop Manager to be on call during agreed periods, which may result in occasional weekend, evening and overnight work according to the changing needs of the business. WHY JOIN ECLIPSE? • Work on high-profile, creative, and technically challenging live events, • Be part of a dynamic and collaborative production environment, • Opportunity to lead and shape a high-performing workshop team, • Contribute to innovative and ambitious scenic builds Our Commitment to Diversity We are an Equal Opportunities Employer and are committed to tackling systemic inequalities by being proactive in creating opportunities for people from under-represented groups. With this in mind, we welcome applications from all ethnic backgrounds, religions, gender identifications and sexual orientations, and from anyone who considers themselves to have a disability. Company Benefits • Company pension, • Employee Assistance Programme, • Enhanced sick pay, • Electric vehicle salary sacrifice, • Cycle scheme, • Training opportunities, • Career progression, • Social activities with a friendly team, • Long service awards, • ‘Refer a friend’ reward scheme, • Health Cash plan, • Technology salary sacrifice scheme, • Birthday day leave, • 2 days volunteering days, • Enhanced paternity pay (2 weeks full pay), • Enhanced maternity pay (8 weeks full pay)

Permanent, Full Time ( 36 hours a week over 52 weeks a year)The Commercial Industries and Access School at Kingston College is seeking an experienced Hair, Beauty and Barbering Technician to oversee the day-to-day operation of our commercial salon. Youll play a key role in maintaining a professional, industry-standard environment that supports both income generation and outstanding student learning.This varied role combines technical, operational and supervisory responsibilities. Youll be responsible for achieving income targets, delivering an excellent client experience, supporting student assessments and ensuring compliance with College policies and awarding body requirements.Were looking for a qualified professional with a Level 3 qualification in Hair, Beauty or Barbering and experience working in a commercial salon environment. Experience within Further Education is desirable. You will have proven experience of supervising staff, alongside a strong understanding of stock control, salon operations, Health & Safety and COSHH requirements.Youll be confident using IT systems and ideally, hold Assessor and IQA qualifications. Knowledge of VTCT and/or City & Guilds qualifications would be advantageous.The successful candidate will be eligible for any increase in salary as a consequence of the annual cost of living review that will be implemented in the new academic year.Closing date for the return of completed applications is 5th July 2026.Interviews will be held on 8th July 2026.The benefits package includes generous annual leave of 27 days plus up to 8 additional days over Christmas/New Year as well as an additional 5 days Wellbeing leave to enhance employees physical and mental health. There is an excellent pension scheme that receives a significant financial contribution from the employer (Teachers Pensions or Local Government Pension Scheme), subsidised sports facilities and professional development and training plus a salary sacrifice cycle to work scheme. South Thames Colleges Group is an equal opportunities employer and is committed to safeguarding and promoting the welfare of children and vulnerable adults.As outlined in the Public Sector Equality Duty of the Equality Act 2010, we are committed to equality of opportunity for all staff and applications from individuals are encouraged regardless of age, disability, sex, gender reassignment, sexual orientation, pregnancy and maternity, race, religion or belief and marriage and civil partnerships.As part of our due diligence checks on prospective employees, successful candidates will be subject to an enhanced DBS check, satisfactory references, an online search and proof of eligibility to work in the UK.The South Thames Colleges Group is made up of Carshalton College, Kingston College, Merton College and South Thames College, which merged on 1 August 2017. South Thames Colleges Group is one of Londons largest providers of post-16 education and training and is an ongoing and significant contributor to its local communities. We aim to put students success at the heart of everything we do.We are looking for hard-working and collaborative people who can join our team and help challenge our students to progress and achieve.TPBN1_UKTJ

Job Title: Lead Electrical EngineerLocation: Worcester Park, SurreyPackage: £48,000Working Hours: Days Only 4 on 4 off pattern (7am 7pm)About the Role:We are seeking a skilled and motivated Electrical Engineer to join my clients team on a days only shift pattern, covering a commercial site in Worcester Park. This is an exciting opportunity for an experienced engineer who has been longing for a professional and progress team of engineers, support by management who reward their staff with training, promotions and development in technical abilities where possible.This company are a well-established business who are leaders in the European FM market, with endless career development.Key Responsibilities:Carry out Planned Preventative Maintenance (PPM) and reactive tasks on electrical three-phase systems, lighting and power distribution.Perform tests on fire alarms, emergency lighting, sprinklers and other compliance systems.Carry out checks to building equipment and systems such as Generators, Splits, AHU/FCUs, Motors, Pumps, LTHWS etc.Monitor BMSDiagnose and resolve M&E faults quickly and efficiently.Ensure all work is carried out in compliance with health and safety regulations.Requirements:Level 3 or equivalent in Electrical Installation/EngineeringProven experience in a similar building maintenance role.Knowledge of commercial building systemsIf you feel you will be a great match to this position, please call James at The Invictus Group on 07375533362.TPBN1_UKTJ

Flexographic Printer About the Company We are currently recruiting for a Flexographic Printer to join a well-established label and packaging manufacturer. This role is ideal for an experienced printer looking to work with modern flexographic printing equipment in a fast-paced production environment. About the Role You will be responsible for operating and maintaining flexographic printing presses to produce high-quality printed materials on substrates such as self-adhesive paper and film. The role involves setting up printing plates, mixing inks, monitoring print quality, and ensuring production targets are achieved safely and efficiently. Responsibilities Set up and operate 8-colour flexographic printing presses (BOBST M4, Mark Andy) Mount printing plates and cylinders correctly Prepare and mix inks to required colour specifications Adjust machine settings including speed, pressure, and alignment to ensure print quality Monitor print runs for colour accuracy, registration, and consistency Inspect printed materials for defects and maintain quality standards Perform routine machine maintenance and cleaning Troubleshoot mechanical and printing issues during production Maintain production records and job documentation Follow all health and safety regulations and company procedures Requirements Previous experience operating flexographic printing presses Knowledge of printing processes, substrates, and inks Ability to read job sheets and technical specifications Strong attention to detail and quality control Good mechanical aptitude and problem-solving skills Ability to work under production deadlines Team player with good communication skills Salary & Benefits Salary from £35,000 DOE Company pension Cycle to Work scheme Life insurance Free parking On-site parking Working Hours Monday to Friday rotating shifts: Monday – Thursday: 05:50 – 13:25 13:25 – 21:00 Friday: 06:00 – 12:00 12:00 – 18:00

Print Project Manager We are currently recruiting for an experienced Print Project Manager to join a creative production business delivering high-quality print, fabrication and rollout projects for luxury brands and cultural institutions. This is a hands-on project management role overseeing projects from initial brief through production and installation, acting as the main client contact while coordinating internal creative, print and fabrication teams. Key Responsibilities: • Manage client accounts and print-led projects from brief to delivery, • Interpret briefs and convert them into clear production instructions, • Coordinate design, print, fabrication, logistics and installation teams, • Prepare and manage quotes, budgets and project costs, • Manage rollout data, spreadsheets and campaign schedules, • Lead creative discussions and support concept development, • Maintain strong client relationships and identify repeat business opportunities, • Ensure compliance with health & safety and sustainability procedures Skills and Requirements: • Experience in print production, creative project management or similar, • Strong organisational and time management skills, • Ability to manage multiple projects to tight deadlines, • Commercial awareness with experience managing budgets, • Excellent communication and client-facing skills, • Confident using Excel and Microsoft Office, • Proactive, flexible and solution-focused

Drainage Operations Manager Location: London Salary: £55,000 - £65,000 + Company Vehicle + Bonus Contract Type: Permanent, Full Time Are you an experienced Drainage Operations Manager looking for the opportunity to build and grow a division rather than simply maintain one? We are recruiting on behalf of a growing London-based property services business looking for a hands-on and commercially minded Operations Manager to lead their drainage division through an exciting period of expansion. This is a key leadership role for someone who takes pride in high standards, enjoys building strong teams and wants to make a genuine impact within a respected family-run business. The Role Managing the daily operation of the drainage division Leading and developing drainage engineers and coordinators Improving workflows, processes and operational performance Overseeing reactive drainage works, CCTV surveys, repairs and excavations Reviewing and approving quotations produced by engineers Supporting recruitment, onboarding and team growth Maintaining high standards across health & safety, reporting and client communication Helping implement an out-of-hours and on-call service Working closely with senior management to improve efficiency, profitability and customer service This is a role for someone who can lead from the front, hold standards and build a positive culture where engineers take pride in their work. About You We are keen to speak with experienced drainage professionals who have previously managed operational teams within the drainage sector. You will ideally have experience with: Managing drainage engineers or field-based operational teams Reactive and planned drainage maintenance, CCTV surveys, jetting, excavations and drainage repairs Scheduling, workflow management and operational planning Leading teams in fast-paced environments Client communication and commercial awareness Driving operational improvements and team growth Whats on Offer? Salary between £55,000 - £65,000 depending on experience KPI-based bonus structure Company vehicle and fuel card Overtime opportunities Long-term progression opportunities Opportunity to build and develop your own team This is an excellent opportunity for a strong Drainage Operations Manager who wants more ownership, more influence and the opportunity to build something long term. To apply or discuss the opportunity in confidence, please get in touch with Kristian today on 01737 452 501. TPBN1_UKTJ

Lead Paramedic Primary Care Home Visiting Service ?? Location: Sutton, South London? Full-Time?? Salary: Competitive Dependent on Experience, Rota Pattern & Unsocial HoursAbout the Role An exciting opportunity has arisen for an experienced and motivated Paramedic to join a well-established Primary Care Home Visiting Service as a Lead Paramedic.This senior clinical leadership role combines hands-on patient care with team leadership, clinical supervision, service development, and quality improvement. The successful candidate will play a key role in supporting a team of Paramedics delivering urgent and proactive care to patients within their own homes, helping to reduce avoidable hospital admissions and improve patient outcomes.This is an excellent opportunity for an experienced Paramedic looking to progress into a leadership position within Primary Care.Key Responsibilities Clinical Leadership & Team Management Provide clinical leadership, supervision, and support to Home Visiting Paramedics and Coordinators.Support complex clinical decision-making and patient management.Provide mentoring, coaching, and professional development opportunities for the wider team.Lead clinical audits, case reviews, and quality improvement initiatives.Support service delivery and ensure safe, effective patient care.Participate in multidisciplinary team meetings and collaborative working.Clinical Practice Assess, diagnose, and manage patients in their own homes and community settings.Deliver advanced clinical assessments and evidence-based treatment plans.Provide continuity of care through appropriate follow-up and safety-netting.Prescribe or recommend medications within scope of practice.Support proactive care planning for patients with complex health needs.Maintain accurate and high-quality clinical records.Service Development & Governance Support the implementation of clinical governance frameworks.Contribute to service development, innovation, and transformation projects.Assist with quality assurance, performance monitoring, and CQC readiness activities.Promote best practice and continuous service improvement.Essential Requirements ? Registered Paramedic with HCPC registration? Minimum 5 years' post-registration experience within Primary Care, Community, Urgent Care, or Emergency Care settings? Proven ability to work autonomously in complex clinical situations? Experience providing clinical supervision, leadership, mentoring, or line management? Strong communication, organisational, and problem-solving skills? Understanding of clinical governance, audit, and quality improvement processes? Full UK Driving Licence and access to a vehicleDesirable Requirements ? Advanced Clinical Practitioner (ACP) qualification or working towards ACP status? Postgraduate qualification relevant to advanced or community practice? Experience working within Primary Care Networks (PCNs)? Experience supporting service transformation and innovation projects? Understanding of integrated care models and population health managementWhat We Offer Opportunity to shape and develop an innovative Home Visiting ServiceSenior leadership role within a supportive Primary Care environmentOngoing professional development and training opportunitiesCollaborative multidisciplinary workingOpportunity to make a genuine difference to patient care within the communityCompetitive salary package dependent on experience and rota commitmentsInterested? If you are an experienced Paramedic looking to take the next step in your career and play a key role in developing community-based healthcare services, we would love to hear from you.Apply today with your CV or contact us for a confidential discussion.Kind Regards Daniel Manager Main Line - 02039078570TPBN1_UKTJ

Permanent, Part Time (0.8)Please note that this post is funded for the 2026/27 academic year onwards so the successful candidate would not be expected to commence in post prior to August 2026.At Kingston College, we are seeking a Lecturer to teach across a range of levels from Level 1 through to Degree level, with a focus on the T Level in Early Years and Childcare. You will be responsible for the effective delivery and assessment of learners through practical sessions, online learning and work-based placements, while also supporting the development of their commercial awareness, employability and enterprise skills. You will ensure that all health and safety policies and placement requirements are adhered to at all times.This role combines teaching with personal tutoring across a range of programmes and will also include assessments in settings. T levels are predominantly exam based and therefore we seek an innovative practitioner to design engaging assignments with practical work placements that inspire learners. You will also contribute to internal verification processes and participate in external verification activities.With an industry background in Early Years and School Provisions (SEN experience is desirable)and a relevant degree or professional qualification, you will hold a teaching qualification (or be willing to work towards). You will bring energy, enthusiasm, and a genuine passion for education and your subject area. An assessor qualification such as CAVA or TAQA is required, along with an awareness of academic quality standards.You will have excellent teaching skills and experience of delivering on higher education programmes, with the ability to support, motivate and empathise with learners while effectively monitoring their progress. Strong organisational and administrative skills are essential, together with good general IT skills, including proficiency in Word, Excel, PowerPoint and email.The successful candidate will be eligible for any increase in salary as a consequence of the annual cost of living review that will be implemented in the new academic year.Closing date for the return of completed applications is 7th July 2026.Interviews will be held on 10th July 2026.The benefits package includes generous annual leave of 40 days, plus up to 8 additional days over Christmas/New Year as well as an additional 5 days Wellbeing leave to enhance employees physical and mental health. This leave is all in addition to Bank Holiday entitlement. There is an excellent pension scheme that receives a significant financial contribution from the employer (Teachers Pensions or Local Government Pension Scheme), subsidised sports facilities and professional development and training plus a salary sacrifice cycle to work scheme. The benefits package will be pro-rated for part time staff.South Thames Colleges Group is an equal opportunities employer and is committed to safeguarding and promoting the welfare of children and vulnerable adults.As outlined in the Public Sector Equality Duty of the Equality Act 2010, we are committed to equality of opportunity for all staff and applications from individuals are encouraged regardless of age, disability, sex, gender reassignment, sexual orientation, pregnancy and maternity, race, religion or belief and marriage and civil partnerships.As part of our due diligence checks on prospective employees, successful candidates will be subject to an enhanced DBS check, satisfactory references, an online search and proof of eligibility to work in the UK.The South Thames Colleges Group is made up of Carshalton College, Kingston College, Merton College and South Thames College, which merged on 1 August 2017. South Thames Colleges Group is one of Londons largest providers of post-16 education and training and is an ongoing and significant contributor to its local communities. We aim to put students success at the heart of everything we do.We are looking for hard-working and collaborative people who can join our team and help challenge our students to progress and achieve.TPBN1_UKTJ

Our client is a very successful manufacturing business and Staffbase have been appointed to recruit for the position of Engineering / Maintenance Supervisor.Salary £65K + BenefitsWe are seeking an experienced electrical bias engineer with excellent management and/or supervisory experience to manage and control electrical engineering and maintenance and CAP-ex projects activities at a large heavy industry processing plant near Croydon.The Role:The Engineering / Maintenance Supervisor will be responsible for overseeing all planned & reactive electrical maintenance activities and project work.Your duties will include but is not limited to the following;Maintain and develop the existing CMMSManagement & control of a small team of maintenance engineers and also external contractorsPlan, manage and control all maintenance activities and engineering projectsEffective Budget and CAPEX Project managementMonitoring, sourcing and ordering spare and replacement partsEnsure adequate staff training, recruitment and disciplinary needs are metAdopt a continuous improvement approach and help to deliver efficiency and cost savings where possibleEnsure compliance with all legal and HSE requirementsProvide 'Hands-on' assistance with electrical and mechanical engineering maintenance and repair of plant and machinery.Candidate:You will be a competent electrical engineer with previous maintenance manager or supervisory experience.Ideally with previous experience in heavy industry manufacturing environment e.g. foundry, quarry, recycling or chemical manufacturing.You will have at least 5 years management /supervisory experience and you must me confident in leading a team of engineers and external contractors.You will hold recognised electrical engineering qualification and ideally you will be trained in health & safety management to IOSH or NEBOSH level.You will have a recognised qualification in electrical engineering e.g. HNC, degree or 18th edition certification and you will have good knowledge and understanding of plc systems.We are seeking a highly organised and effective leader who will maintain a visible presence on the shop floor.Hours of Work:Monday to FridayBenefits:Excellent basic salary Negotiable £65K + benefitsBonus31 days annual leavePensionTPBN1_UKTJ

Production Operatives Multiple Vacancies | Immediate Starts Available 📍 Wimbledon (Applicants must be local to Wimbledon due to early start – 45mins max commute) ⏰ Monday–Friday | 6:30am–3:00pm We’re recruiting multiple Production Operatives to join a well‑established and growing manufacturing company in Wimbledon. With quick starts available, this is an excellent opportunity for experienced production staff looking for stable, weekday work in a clean, regulated environment. If you’ve worked in manufacturing before - whether assembly, food, pharmaceutical, cosmetics, chemicals or similar - we want to hear from you. 🧩 The Role You’ll be a key part of the production team, contributing to high‑quality manufacturing while following strict GMP standards. Duties include: • Operating production line equipment in line with GMP requirements, • Accurately following SOPs, • Weighing, mixing, packing, or assembling products, • Completing production and quality documentation, • Maintaining a clean, safe, and organised work area, • Adhering to all health & safety, hygiene, and quality procedures ✅ What We’re Looking For • Previous experience in any manufacturing/ production/ assembly job, • Experience using production or manufacturing equipment, • Strong attention to hygiene, cleanliness, and quality standards, • Ability to follow processes and work accurately, • Reliable, punctual, and comfortable with early starts, • Applicants must live within a 45‑minute commute of Wimbledon ⭐ What’s in It for You? • Immediate starts & multiple positions available, • Consistent day shifts only (6:30am–3:00pm), • Monday to Friday – your weekends are yours, • Supportive and friendly team environment, • Full training and ongoing support, • Stable, long‑term opportunities within a regulated facility If you’re a Production Operative with some initial experience looking for a quick start, reliable hours, and a great work–life balance, apply today and secure your next role!

Electrical Project Manager / Senior Electrical Project Manager | M&E Building Services | South London | £75,000-£95,000 + PackageThis is a fantastic opportunity for an experienced Electrical Project Manager or Senior Electrical Project Manager to join a respected M&E Building Services contractor delivering exciting and varied projects across London and surrounding areas.Projects span the commercial, commercial fit-out, healthcare, education, residential, mixed-use, industrial, and public sector markets, with typical project values ranging from £1m-£4m, alongside larger projects where applicable.This role offers the opportunity to join a business with a strong reputation for quality, repeat business, and long-term client relationships, whilst benefiting from a supportive culture and genuine career progression opportunities.The CompanyThis established M&E Building Services contractor has built an excellent reputation for delivering high-quality electrical building services projects across a diverse range of sectors.Known for its collaborative and down-to-earth culture, the business continues to secure repeat business from long-standing clients and offers employees genuine responsibility, autonomy, and opportunities to progress their careers.The Role Electrical Project Manager / Senior Electrical Project ManagerThe successful candidate will play a key role in delivering electrical building services projects from pre-construction through to successful completion and handover.Working closely with clients, consultants, subcontractors, and internal teams, you will ensure projects are delivered safely, efficiently, on programme, and to the highest standards.Responsibilities will include:Managing electrical building services projects from inception through to handoverCoordinating labour, subcontractors, suppliers, and site teamsManaging programme delivery and project performanceMaintaining strong client and stakeholder relationshipsEnsuring quality, health and safety, and technical compliance requirements are metSupporting commercial performance and project reportingRequirementsExperience working as an Electrical Project Manager, Senior Electrical Project Manager, Electrical Contracts Manager, or similar role within M&E Building ServicesStrong technical understanding of power, lighting, containment, distribution systems, fire alarms, and associated electrical servicesExperience delivering building services projects across one or more sectors including commercial, fit-out, healthcare, education, residential, industrial, or mixed-use developmentsStrong organisational, communication, and client-facing skillsGood commercial awarenessFull UK Driving LicenceRemuneration Package Electrical Project Manager / Senior Electrical Project Manager£75,000-£95,000Car Allowance or Company VehicleAnnual BonusPensionPrivate HealthcareLife AssuranceTraining and Development OpportunitiesGenuine Career Progression OpportunitiesAdditional Benefits PackageNext StepsIf you would like to be considered for this Electrical Project Manager / Senior Electrical Project Manager position, please apply online today, or contact Rob at David Leslie Ltd for an informal and confidential discussion.About David Leslie LtdDavid Leslie Ltd is a family-run construction recruitment consultancy with over 20 years' experience connecting professionals and employers across the UK. Specialising in the Building, Fit-Out, and M&E Building Services sectors, our approach is built on trust, integrity, and long-term partnerships, ensuring both clients and candidates receive a service that is personal, transparent, and expertly delivered.This role would suit candidates currently working as:Electrical Project Manager, Senior Electrical Project Manager, Electrical Contracts Manager, M&E Project Manager, Electrical Building Services Manager, MEP Project Manager.TPBN1_UKTJ

About Us DaVita UK delivers life-saving kidney care to over 2,000 patients across England & Wales. DaVita UK is one of the 14 countries which form DaVita International focusing on transforming care and improving quality of life for people receiving dialysis treatment globally. When you join the DaVita Village, you're joining a winning team with Community First, Company Second culture We’re proud to be an independent, nurse-led provider, working in partnership with the NHS to deliver the highest standards of care using cutting-edge technology in welcoming, modern environments. Job Overview The Capital Projects Manager will lead the delivery of capital development projects across a private healthcare organisation, ensuring schemes are completed safely, on time, and within budget. Experience working within healthcare environments is essential, and experience supporting the setup or expansion of dialysis services is a strong advantage. The role works closely with clinical teams, estates, procurement, and external contractors. Technical compliance will be supported by Authorising Engineers (AE) and Authorised Persons (AP), so deep technical HTM/HBN expertise is desirable but not essential. Key Responsibilities • Deliver end‑to‑end project management including feasibility, design coordination, construction oversight, commissioning, and handover., • Manage refurbishment and expansion projects within live clinical settings, ensuring patient safety and minimal disruption., • Work collaboratively with clinical leads, estates teams, infection prevention, finance, and external suppliers., • Ensure projects align with CQC requirements, relevant Health Building Notes, HTMs, health & safety legislation, and internal governance processes., • Manage project budgets, monitor spend and report financial performance., • Maintain risk registers and assurance documentation throughout the project lifecycle., • Manage tendering, contract negotiation, and performance monitoring of contractors and consultants., • Provide clear progress updates, milestone tracking, and risk escalation to senior leadership. Essential Experience & Skills • Proven experience managing capital or estates projects in NHS or private healthcare environments., • Ability to work effectively with contractors, designers, engineers, and specialist suppliers., • Strong financial oversight and cost‑control capability., • Ability to collaborate across clinical and non‑clinical teams., • Experience maintaining project governance, risk logs, and assurance documentation., • Comfortable operating within formal estates governance frameworks where technical sign‑off is provided by AE/AP roles. Skills & Experience: • Proven experience managing digital projects within an agency environment, ideally across CMS and e-commerce platforms, • Expertise in RIBA Design formats and delivery throughout the project, maintain key project documentation, including RAID logs, delivery plans, and status reports structured involvement and record., • Highly organised with strong attention to detail and structured communication skills, • Excellent client-facing abilities—professional, composed, and credible under pressure, • Strong financial management skills, including budgeting, forecasting, and reporting, • Comfortable engaging in technical discussions with developers and architects, • Skilled in writing user stories, acceptance criteria, and managing backlogs, • Solid understanding of Agile methodologies and delivery governance, • Strong reporting and documentation discipline, with clear visibility across project status, • Willingness to travel to London and occasionally across the UK for client meetings and workshops, • A collaborative team player with a positive, balanced approach to delivery Desirable Experience • HTM/HBN familiarity — Understanding of healthcare technical standards is beneficial but not essential due to AE/AP oversight., • Experience supporting renal or dialysis service projects., • Understanding of commercial drivers and patient‑experience priorities., • Degree educated / Hold an equivalent qualifications in project management, • Hold a IOSH managing safety training or equivalent, • Trained in CDM responsibilities What We Offer • Competitive Salary, • 27 days annual leave including 8days bank holidays., • Company Pension Scheme., • Life cover equivalent to 3 times annual salary, • Employee discount shopping schemes on major brands and retailers, • Electric car scheme, • Cycle to work scheme, • Holiday purchase scheme, • Broad range of learning opportunities, such as professional qualifications, collective/individual training, and personalised support programmes, • Attractive Employee Referral Rewards Scheme, • End of Year Voucher, • 24/7 Employee Assistance Program and access to a mental wellbeing, • An exciting, collaborative and driven multinational environment., • A "community first, company second" culture based on Core Values that really matter., • To live our mission: To be the Provider, Partner, and Employer of Choice., • Dedication: above all, to caring for our patients and teammates

An established and highly regarded M&E and Facilities Management provider is seeking an experienced FM Estimator to join its commercial and bid team. With a strong focus on public sector delivery, particularly within healthcare and education, the business is committed to driving growth through competitive tendering and high-quality solution development.This is a pivotal role within the organisation, responsible for developing accurate, commercially viable pricing solutions that support the successful win of new contracts, typically ranging from £250k to £2m per annum .Key Responsibilities Lead pricing activity across Facilities Management bids, taking full ownership of the commercial submissionDevelop and manage end-to-end pricing models, including labour loading, cost planning, scenario modelling, and subcontractor pricingTranslate operational solutions into robust and competitive commercial proposalsCoordinate with internal stakeholders and subcontractors to gather information and pricing in line with tender deadlinesIdentify, assess, and manage commercial risks and opportunities within bidsSupport governance and bid review processes, clearly articulating pricing methodology and decisionsContribute to mobilisation planning, including transition and cost validationContinuously enhance pricing models, methodologies, and bid processesEnsure compliance with bid/no-bid procedures and escalate risks where requiredKey Duties Support Business Development Managers and Bid Managers throughout the full sales lifecycleManage multiple bid deadlines effectively, ensuring high-quality submissionsDeliver both compliant and variant bid models where requiredComplete all client pricing documents and provide clarifications for submissionEvaluate operational and commercial risks prior to bid submissionStrengthen and diversify the subcontractor and supply chain networkSupport contract handover and mobilisation processes following successful bidsIdentify opportunities for contract optimisation and highlight risk areas during transitionSupport adherence to Health & Safety standards within proposalsAbout You Proven experience in pricing and estimating FM contracts , ideally within healthcare, education, or public sector environmentsStrong understanding of hard FM services , including SFG20 planned maintenance regimesKnowledge of HTMs and public sector bidding frameworksCommercially astute, with the ability to develop detailed and accurate pricing modelsAdvanced Excel skills and strong analytical capabilityExperienced in working within bid teams and engaging with senior stakeholdersAble to manage multiple priorities in a fast-paced, deadline-driven environmentOperational awareness to complement technical and commercial decision-makingTPBN1_UKTJ

Process Automation Engineer (12 Month FTC) | £55,000 - £65,000 + Benefits | Location: CroydonWe are recruiting a Process Automation Engineer on behalf of a highly successful manufacturing business experiencing significant growth and investment across its operations.This is an exciting opportunity to join a market-leading manufacturer and play a key role in delivering automation and process improvement projects across a modern production environment. The position will focus on identifying, developing and implementing automation and process improvement solutions that enhance safety, quality, productivity and operational efficiency across the manufacturing operation.The role would suit candidates from manufacturing, FMCG, food, pharmaceutical, chemicals, plastics, packaging, medical device, automotive or other industrial production environments.The role:Lead automation projects from concept through to commissioning and handoverDesign and implement automation solutions to improve manufacturing performanceIdentify, evaluate and implement process improvement opportunities through automation, digital technologies and engineering solutionsIdentify opportunities to automate manual or repetitive processesDeliver projects safely, on time and within budgetWork with suppliers, OEMs and system integrators to specify, procure and implement solutionsSupport the development of future automation and digital manufacturing initiativesImprove operational performance through the use of PLCs, control systems, sensors, robotics and monitoring technologiesCollaborate with Production, Engineering, Maintenance, Quality, Supply Chain and IT teamsConduct risk assessments and ensure compliance with health, safety and machine safety requirementsDevelop and maintain technical documentation, standards and operating proceduresSupport data capture, reporting and system integration to improve operational visibility and decision-makingDrive continuous improvement through automation, process optimisation and innovationCandidate requirements:Degree qualified or equivalent experience within Automation, Manufacturing, Electrical, Controls, Process or Production EngineeringExperience delivering automation, manufacturing improvement or process optimisation projects within a manufacturing or industrial environmentStrong project management and stakeholder management skillsExperience working with PLCs, HMI, SCADA or industrial control systemsExperience managing suppliers, contractors and external partnersStrong analytical and problem-solving skillsAbility to work independently whilst managing multiple prioritiesExcellent communication and collaboration skillsContinuous improvement mindset with a focus on delivering measurable business benefitsExperience with robotics, machine vision systems or advanced sensing technologiesKnowledge of MES, IIoT, Industry 4.0 or digital manufacturing platformsExperience within manufacturing engineering, process engineering, continuous improvement or industrial automation environmentsFormal project management qualification such as PRINCE2 or PMPUnderstanding of machine safety and functional safety standardsThis is an excellent opportunity to join a growing international manufacturer investing heavily in automation, technology and operational excellence. The role offers genuine project ownership and the opportunity to make a visible impact within a highly successful business.If this sounds like the opportunity you have been looking for then please apply by attaching your CV.Keywords:Process Automation Engineer, Automation Engineer, Process Engineer, Manufacturing Engineer, Continuous Improvement Engineer, Controls Engineer, Automation Project Engineer, Industrial Automation Engineer, PLC Engineer, Manufacturing Improvement EngineerSmartsearch takes your privacy seriously and will only use your personal information to administer your application. To effectively process your application, we may share your details with the hiring company and Smartsearch or the company may contact you by email, telephone or SMS. A copy of our privacy policy will be emailed to you upon receipt of your application..TPBN1_UKTJ