Clean team jobs in NewtownabbeyCreate job alerts

Senior Java Developer - £70,000 to £100,000 3 Days On-Site | Central Belfast | Cutting-Edge Projects The Opportunity My client is looking for an experienced Senior Java Developer to join a growing engineering team in the heart of Belfast. This is a chance to work on technically challenging, high-impact projects in a collaborative, innovation-driven environment. This client have invested in creating a modern, well-appointed office space designed for productivity, creativity, and teamwork. You'll spend three days a week on-site with like-minded engineers, sharing ideas and solving problems together, with two days to focus from home. What You'll Do Design, develop, and deliver scalable, secure Java applications Collaborate with cross-functional teams to shape technical solutions Optimise performance, reliability, and maintainability across our services Participate in code reviews, mentoring, and knowledge sharing Contribute to architectural decisions and best practice adoption What You'll Bring Strong commercial experience in Java (Spring Boot, microservices) Experience with cloud platforms (AWS or similar) and containerisation (Docker, Kubernetes) Solid understanding of REST APIs, database design (SQL/NoSQL), and integration patterns Commitment to clean code, automated testing, and CI/CD practices Ability to thrive in a collaborative, Agile environment Why Join Now? Competitive Salary - £70,000 to £100,000 based on experience Hybrid Balance - 3 days in our central Belfast office, 2 days remote Modern Workspace - a purpose-built, inspiring environment Interesting Work - projects that make a real impact, using modern tech stacks Supportive Culture - a team that values innovation, growth, and collaboration If you're ready to take the lead on challenging projects and want to work with a forward-thinking company in a fantastic central Belfast location, we'd like to hear from you. Apply Now - Connect with Ryan Quinn on LinkedIn or send your CV directly. Skills: Java Microservices AWS Event-driven Benefits: Bonus

Lettings Valuer Staffline Ireland recruiting for a Lettings Valuer on behalf of a leading Estate Agent. The company operates in private residential and new homes sales, premier homes and country estates, as well as land sales and consultancy. Services also include lettings, property management, mortgages and financial services. Responsibilities: Accurately assess market rental values for a diverse range of properties. Negotiate lettings terms with tenants and landlords, including: Conducting property viewings Managing applications and reference checks Coordinating deposit and rent collection Preparing and executing tenancy agreements Handle tenancy-related issues with professionalism and efficiency. Oversee tenancy renewals and rent reviews in line with current legislation. Prepare termination notices in compliance with legal standards. Ensure full adherence to property legislation and industry regulations. Deliver exceptional customer service and maintain high client satisfaction. Any other duties role may involve. Person Specification: Previous experience in a similar role. Strong knowledge of property legislation and compliance requirements. Strong interpersonal skills with the ability to collaborate effectively as a team player. Proficiency in IT and familiarity with relevant software applications. A full, clean UK driving license is essential. The Rewards The successful Lettings Valuer will enjoy a competitive salary depending on experience. Location The Lettings Valuer role will be based in Belfast. To be considered for this position, please forward your CV to Ross McConville at Staffline Ireland by clicking on the APPLY button on this page and attaching your CV. The Staffline Ireland Specialist Team is a dedicated division within Staffline Ireland, focused on providing Permanent, Contract & Temporary staffing solutions across; Construction, Engineering, Accountancy & Finance, Financial Services & Insurance, Health & Safety, HR, IT, Sales & Marketing, Senior Manufacturing, Procurement & Supply Chain & Medical, Health & Social Care. Skills: Lettings Viewings Tenancy Agreements

With every community, Stantec redefines whats possible . Application Deadline: Recruitment is ongoing. Please apply as soon as possible as the advert may close once we have sufficient applicants. Your role: We are looking for a Graduate Process Engineer to be based in Belfast, joining our 2026 Graduate Programme. We have an exciting opening for an aspiring Process Engineer to join our dynamic and collaborative team, where you will have the opportunity to contribute on high profile projects, both locally and nationally. You will develop your technical skills and knowledge alongside senior engineers, gaining invaluable exposure to the water industry whilst working on a range of developments from wastewater treatment and water recycling to clean water solutions exploring the potential of nature-based solutions is a top priority. You will analyse and interpret data to inform project decisions, contribute to the design and development of engineering solutions, collaborate effectively with multidisciplinary teams, and foster strong relationships with clients and stakeholders. We work on the whole project lifecycle from optioneering through to detailed design and implementation, and there is a possibility of site visits and investigations to broaden your understanding. Take a look at our Water business line here:- Water ( and review the career journey of one of our Graduate Process Engineers here:- My Stantec Story Building a career as a graduate process engineer with Ross Sullivan About you: At Stantec, we value your potential over past experience. Along with your Bachelors degree in Chemical Engineering and a keen interest in the water industry, wed love to receive your application if you are:- An Adapter - You're able to remain calm in new and changing situations, comfortably switching between a variety of dynamic and exciting tasks. A Perseverer - You stay composed in the face of setbacks, approaching challenges with confidence and determination. A Collaborator - You work effectively with lots of different people, considering others perspectives to shape better outcomes. A Problem-Solver - You love to give your thoughts based on what you see, being unafraid to challenge conventional thinking. Please note, we ask our graduates to come into the office 4 days per week, to ensure that colleagues are able to provide the appropriate level of support. What we can offer you: A competitive salary Private medical insurance A range of benefits, including holiday buy and sell, group income protection and life assurance Permanent employment contract to demonstrate our commitment to your long-term career at Stantec Professional progression plan, supporting you to become chartered with ICE. A supportive and collaborative team environment and Early Careers peer group and wider ERG network (see more on our ERGs here: Stantec Employee Resource Groups) Applicants must have an unconditional right to live and work in the UK for an indefinite period without limitation. Please take a look at our Graduate FAQs ( Graduate Application FAQs ) if you have any questions. We look forward to receiving your application! NextGen #StantecCareers #UKGraduate About Stantec The Stantec community unites more than 32,000 employees working in over 450 locations across 6 continents. We have been working with our clients and communities in the UK for over 150 years. We plan, design, deliver and manage the development and infrastructure needed to support the creation of sustainable, healthy and prosperous communities. Our teams provide effective and relevant solutions, translating our clients vision into valued consents, deliverable plans for projects and programmes, and efficient designs for delivery, based on technical excellence and deep market insights. We deal with todays challenges, but also keep a fairer, better tomorrow in sight, looking at how we deliver clean growth, support radical changes in our economy and meet the needs of future communities. Stantec provides equal employment opportunities to all qualified employees and applicants for future and current employment and prohibit discrimination on the grounds of race, colour, religion, sex, national origin, age, marital status, genetic information, disability, sexual orientation, gender identity or gender expression. We prohibit discrimination in decisions concerning recruitment, hiring, referral, promotion, compensation, fringe benefits, job training, terminations or any other condition of employment. Stantec is in compliance with laws and regulations and ensures equitable opportunities in all aspects of employment. Building an inspired, inclusive work environment that attracts, supports, and develops world-class talent is a crucial key to our success. If you are excited by this role but worry that your experience doesnt exactly align, we encourage you to apply. At Stantec we are committed to ensuring our recruitment process is accessible to all. If you require reasonable adjustments to be made during the recruitment process then please inform a member of our Talent Acquisition team. ReqID: 7630

Chefs Required - Temp shifts Excel Recruitment is looking to add to our team of experienced Senior Chefs, who work throughout Belfast and the surrounding areas. This is a great opportunity for those chefs who want to work on a temporary basis in various locations & businesses offering great flexibility and career opportunities with mainly daytime Monday to Friday shifts. Chef Requirements Minimum 2 years of experience preparing and cooking in a busy professional kitchen environment Be of a senior chef level, from Senior CDP upwards Available for various shifts, which may include evenings & weekends As cook you will have knowledge of all food safety guidelines Good level of spoken & written English Chef Responsibilities Working in a busy kitchen following the Head Chefs instructions Work on your own section ensuring it is fully set for service Always cook food to the highest standard As Chef you will need to follow your supervisor's instructions Consistently keep yourself and your work area clean Follow all health & safety as well as food safety guidelines Benefits Weekly pay Flexible work shifts Overtime opportunities Accrued holiday pay Mostly daytime Monday - Friday shifts If you are interested in this Temporary Chef position or any other job on the Excel Recruitment website, then please apply below; #BELFHOS Skills: cooking kitchen canteen chef restaurant sous head chef Benefits: WEEKLY PAY

Senior Java Developer - 100% remote. * Salary: up to £70k + bonus+ benefits. About the Company: Our client is a global technology company operating in the payments space. They're investing heavily in their engineering capability across Northern Ireland, with a focus on building modern, scalable platforms that support businesses in managing and growing their operations. Their engineering teams work in small, focused groups, empowered to make technical decisions and deliver real value. It's a flat structure with minimal bureaucracy, encouraging autonomy, experimentation, and continuous improvement. If you enjoy solving real-world problems and building software that matters, this is an environment where you'll thrive. The Role: As a Senior Java Developer, you'll be part of a growing team delivering backend services and portal systems that support core business functions. You'll have the opportunity to work with a range of modern technologies and software development practices, including Behaviour-Driven Development (BDD) and continuous integration/deployment pipelines. The role offers exposure to complex systems architecture and meaningful input into how systems are designed, built, and deployed. You'll work across projects of varying scale, from solo contributions to larger collaborative efforts, all while supported by a strong technical leadership team. Key Responsibilities: * Design and build backend services and web platforms that support key business operations * Write clean, testable code and contribute to system architecture discussions * Work closely with product and engineering teams to ensure solutions align with business needs * Improve development workflows through tooling, automation, and knowledge sharing * Participate in code reviews, estimation, deployment, and system monitoring * Contribute to a culture of continuous improvement and high engineering standards Essential Criteria: * 6-8 years of commercial experience in software engineering * Strong Java development experience (or similar OO language such as C#, Go, or Ruby) * Experience with backend application design, API development, and systems integration * Familiar with relational databases, SQL, caching, and messaging systems * Understanding of web technologies including HTML, CSS, and JavaScript * Knowledge of design patterns, test automation, and modern development best practices * Comfortable working in Linux or Windows environments * Proven ability to translate complex business requirements into scalable software solutions * Strong communication and collaboration skills, with the ability to work independently when needed Why Join * Join a fast-moving product-focused company solving real customer problems * Minimal hierarchy and full engineering ownership of work * Modern tech stack and tooling with continuous delivery in mind * Flexible hybrid working and a high-trust environment * A strong local engineering presence backed by global scale How to Apply: If you're a Java developer looking to build impactful systems in a supportive and technically strong team, apply via the link. Or contact Phil Gamble directly via LinkedIn or WhatsApp for a confidential conversation. About Phil Gamble: Phil Gamble has over 20 years of experience in the Tech recruitment industry, successfully delivering on challenging IT recruitment campaigns in global software companies across the US, UK, and Ireland. He takes a personalised approach to understanding candidates and has garnered praise for his professionalism and dedication to their career goals. Recent LinkedIn Testimonials: "Phil was by far the best recruiter I have ever dealt with..." "Phil has helped me find new roles more than once... He takes the time to understand what I'm looking for..." "Phil is a professional who does not treat his candidates as resources..." Skills: java payments ecommerce

As a Rituals Advisor you are part of our store team. You engage directly with our customers listen to their needs and advise them on which of our products are the perfect match for them. You turn every customer interaction into a memorable customer experience. Being a Rituals Advisor means being a luxury sales advisor with many exciting opportunities to grow in your career. By working closely with your Store Manager and Assistant Store Manager youll reach your personal goals and the goals for the store. Youll interact with customers every day and ensure to provide a best in class customer experience. Youll follow store operational and safety procedures as well as keep the store clean and tidy according to company visual merchandising standards. Qualifications : High on energy low on ego and with a little bit of humour! You are one of a kind because your ability to connect with customers and make them feel at home in our addition as Rituals Advisor you are professional and excited about our brand. You know how to share that excitement by showing our customers how our products can make them feel even better. On top of that you have: • Relevant experience in a similar position within retail or hospitality., • A customer-service mentality and team-players work ethic., • Decision making and problem-solving skills., • Good attention to detail organised and structured. Additional Information : All your information will be kept confidential according to EEO guidelines. Remote Work : No Employment Type : Part-time Key Skills Sales Experience,Presentation Skills,SAAS,Customer Service,Google Docs,Organizational skills,Growing Experience,Communication skills,Retail Sales,Enterprise Sales,Medicare,Lead Generation Experience: years Vacancy: 1

From our Head Office to the shop floor and everywhere in between our primary goal is to create and deliver a fantastic customer journey for everyone who shops at Lidl. Customer obsessed high energy and love learning every day If that sounds like you earn 370 per week as a Customer Assistant on our standard 30 hour contract. Your role will be varied working across different shift times tasks and with different colleagues. What does a normal day* as a Customer Assistant look like (*theres no such thing as normal in retail but weve tried our best!) As a Customer Assistant you are required to sell alcohol therefore you must be 18 or over to work in our store. Shift Patterns: • Morning shift: Starting at 5am or 6am with your team youll be getting our award-winning products fully stocked on the shop floor and our delicious bakery products ready for our customers to enjoy by opening time so they can Go Full Lidl!, • Middle shift:Starting mid-morning or early afternoon youll make sure our stores are spotlessly clean well presented and our products remain fresh all while helping customers with queries on the shop floor and working on tills to minimise till queues, • Late shift:From your start time in the afternoon youll make sure our customers experience is top class by serving them with a smile while on the tills restocking missing items and getting the store ready for the next day, • Interacting with the customer in a pleasant friendly and helpful manner, • Ensuring stock loss controls are followed in all areas of the store, • Maintaining store and external cleanliness and hygiene standards, • Following freshness and rotation principles, • Ensuring all waste is managed correctly, • Assisting in the stock count process, • A can-do attitude and excellent customer service skills, • The willingness to go the extra mile for our customers, • To be responsible and reliable, • To enjoy working in a fast-paced varied environment, • A good team player, • 12.40 per hour rising to 14.10 per hour after 3 years, • Additional supplements paid depending on the days & hours worked*, • 29 days holidays per annum (pro rata including Bank Holidays), • Company pension after 1 year, • Genuine opportunities for career development, • Individuals recognised as high performing will be invited to join our Leadership Academy as part of your on-going development, • Mobile and broadband discounts with Vodafone, • Generous discounts available; Circle K Bike to Work, • Basic Rate 12.40, • 15.50 (Unsocial Hours), • Basic Rate 12.80, • 16.00 (Unsocial Hours), • Basic Rate 13.40, • 16.75 (Unsocial Hours), • Basic Rate 14.10, • 17.63 (Unsocial Hours) Key Skills Time Management,Sourcing,Talent Acquisition,Taleo,ATS,HR Sourcing,Interviewing,Management Experience,Team Management,Human Resources,negotiation,Recruiting Employment Type : Part-Time Experience: years Vacancy: 1

Description SHIFTS YOU ARE APPLYING FOR: 9hrs p/w; Wed 06:00 - 12:30; Thu 06:00 - 09:00 Working as part of a fast-paced store team your top priority will be to locate pack and promptly process stock ensuring its beautifully presented to our customers. When youre needed to work on the salesfloor your outstanding customer service skills will shine return for supporting all Company policies and procedures and having a great attitude to work we will invest in you and your development from day one. Flexible working options are available. About the Role: To be a successful Stock Team Member youwill have perfect products available for our online customers by: • Accurately processing stock quickly and to the highest standard which includes locating packing and promptly transferring stock in and out of store, • Meeting deadlines to always deliver to our customers at the promised time, • Keeping operational areas of the store clean tidy and organised, • Working in all areas of the store as needed including the sales floors to offer fast and friendly service About You: • A great communicator who is friendly calm and efficient even on your busiest days, • Accurate thorough and well organised with excellent attention to detail, • You take pride in your work and approach all tasks with energy pace and dedication, • Happy to work on your own and keep yourself busy to achieve all performance targets, • Flexible supportive and always ready to go the extra mile for your team and our customers This role is not one we would typically consider for sponsorship under the Skilled Worker route due to for example the relevant Home Office requirements on skills level not being met. Candidates are therefore encouraged to consider their own right to work options without Next sponsorship Whats Next As part of your application you will be required to complete an online assessment. This will involve a Working with Numbers Assessment and a Retail Scenarios Assessment. Our in-store recruitment team will then review the successfully completed applications and those that match the job criteria closest will be contacted to arrange an initial Interview so we can have a chat to find out more about you. In order to apply for this position you must not have had an unsuccessful online assessment (as detailed above) in the last 6 months. Best of luck! #Delivery #Assistant #Shop #Packaging #Operative #Colleague #Stockroom Key Skills Dhcp,Ethernet,Information Technology Sales,Customer Development,ITI Employment Type : Full-Time Experience: years Vacancy: 1

Are you an experienced Counter Balance Forklift Driver looking for your next opportunity? Our client in Mallusk is seeking a reliable and hardworking individual to join their busy warehouse team. Main Duties Include: Dealing with warehouse administration related to the role Loading and unloading trailers Scanning and accurately locating inbound freight Carrying out weekly warehouse location checks Ensuring the warehouse and yard are kept clean and organised Shift Details: Core hours: 6am to 2.30pm Later shift every Thursday and every other Saturday morning - Overtime will be paid at time and a half for later shifts worked and Saturday shifts Requirements: Previous experience in a busy warehouse environment Valid Counter Balance Forklift licence PC Literate Administration skills Strong attention to detail and a good team player Salary for the role will start on £26K per year Please send your CV via the link to Colleen Farquharson to apply. Brook Street NMR is acting as an Employment Agency in relation to this vacancy. Skills: Counter Balance Forklift Warehouse Operative Admin Experience Attention to detail

Senior Backend Engineer - Java / Kotlin Overview: My client, a fast-scaling technology-driven marketplace, is seeking a talented Senior Back-End Software Engineer to join their dynamic engineering team. You'll join a collaborative, cross-functional team where your input directly impacts the growth and scalability of a service-oriented platform. This is an opportunity to work on meaningful, production-grade solutions using modern JVM technologies within a cloud-first, microservices environment. Key Responsibilities: Design, build, and enhance core backend services supporting a high-performance marketplace platform Collaborate with product managers, designers, and engineers to deliver robust, scalable solutions Champion clean architecture, performance, and reliability in all stages of development Drive continuous improvement across engineering practices, team processes, and product quality Essential Skills & Experience: Proficient with a modern JVM language (Kotlin, Java, Scala, Groovy, etc.) Proven experience delivering scalable, production-grade applications in a SOA or microservices architecture Comfortable working with CI/CD pipelines and modern deployment workflows Experience with cloud platforms (GCP, AWS, or Azure) Strong understanding of system design, APIs, and distributed systems Collaborative mindset, comfortable working with remote teams across time zones Desirable Skills: Familiarity with containerisation technologies (Docker, Kubernetes) Experience with messaging systems such as Kafka or similar Exposure to Temporal, SpringBoot, and cloud-native patterns is a plus Why Apply? Competitive salary & benefits package Work with cutting-edge technologies Collaborative, high-performing team environment A role where you can have a real impact on product design and architecture For more information about this opportunity, connect with Neill Ferguson on LinkedIn or submit your CV via the link below. Skills: java kotlin scala groovy aws azure Benefits: Work From Home

Work with Us. Change the World. At AECOM, were delivering a better world. Whether improving your commute, keeping the lights on, providing access to clean water, or transforming skylines, our work helps people and communities thrive. We are the worlds trusted infrastructure consulting firm, partnering with clients to solve the worlds most complex challenges and build legacies for future generations. There has never been a better time to be at AECOM. With accelerating infrastructure investment worldwide, our services are in great demand. We invite you to bring your bold ideas and big dreams and become part of a global team of nearly 50,000 planners, designers, engineers, scientists, digital innovators, program and construction managers and other professionals delivering projects that create a positive and tangible impact around the world. The Water Business prides itself on developing innovative techniques to improve the delivery, efficiency, and sustainable outcomes of our projects. We provide a broad range of clients with an end-to-end portfolio of water services, spanning clean water, wastewater, drainage, flood risk management, asset management, and digital solutions across all sectors. As an accredited member of the Institute of Asset Management (IAM), we are recognised for our excellence in asset lifecycle planning and strategic delivery, giving clients confidence in our capability to deliver long-term, sustainable value. This is a fantastic opportunity to join a Water team of over 700 professionals across the UK & Ireland. Were one global team driven by our common purpose to deliver a better world. Join us. Job Description Start here. Grow here. Our Water team is seeking a dynamic and strategic Head of Asset Management to lead and grow our established Asset Management services across the UK and Ireland. As clients increasingly adopt asset management frameworks and analytical approaches (including optimisation, resilience, and systems thinking) to guide the design, operation, and maintenance of water infrastructure, AECOM is committed to being at the forefront of this evolution. By engaging early in our clients' delivery chain, we provide value-driven, whole-life services through our multidisciplinary teams. This is a pivotal leadership role within our UK & Ireland Water business, responsible for driving growth in service capability, client relationships, team development, and commercial performance. Youll be a key strategic figure, shaping the future of asset management for the water sector and contributing to our global community of asset management practitioners. Heres what youll do: Develop and lead Asset Management strategy across key service areas, leveraging expertise in condition assessment, rehabilitation, system dynamics, optimisation, data analytics, urban drainage, and water quality. Build and maintain trusted client relationships, serving as a senior point of contact for asset management services. Grow a robust pipeline of asset management work, enabling the development of team capability and capacity in line with business demand. Drive strong commercial outcomes, with a focus on delivering higher-than-average margins and increasing year-on-year revenue. Personally deliver strategic advisory services and provide oversight to project teams as Project Director. Champion innovation and digital solutions, including forming partnerships with software providers and niche consultancies. Foster a connected and collaborative asset management team across multiple locations and disciplines, supporting both client delivery and professional development. Leverage synergies with AECOMs wider services, enabling integration of engineering, environmental, and commercial expertise into client programmes. Position AECOM as a thought leader, enhancing our brand visibility and reputation within the asset management and advisory space. Enjoy the Perks. At AECOM, you'll enjoy a range of core and personalised benefits designed to support your future and well-being, customised to fit your lifestyle. Take advantage of career development opportunities, our flexible hybrid working model to ensure a work-life balance that suits your lifestyle, technical practice networks, AECOM University, and volunteering days. If you're passionate about innovation and turning bold ideas into reality, AECOM welcomes you. Join our team, where we don't just construct infrastructure but also uplift communities and enhance lives. Why not give our AECOM Water page on LinkedIn a follow to stay updated on the impactful projects we're working on and see firsthand the difference we're making in the industry! Qualifications Ready to push the limits of whats possible? Heres what were looking for: You are an established professional in the regulation, strategic, or tactical asset management space, with a strong profile in the UK and / or Ireland water utility sector. You bring a collaborative mindset and a passion for delivering innovative, sustainable solutions that meet client and societal needs. A recognised track record in strategic or tactical asset management within consulting and/or client organisations. Demonstrated experience in business development and/or technical excellence. A strong appetite for shaping and growing a business area, with the support of a committed leadership team. Proven leadership and collaboration skills, with the ability to unite multidisciplinary teams toward common goals. A history of successful bidding and development of long-term, trusted client relationships. We celebrate diversity, including neurodiversity, and believe it enriches our team. We welcome applications from all backgrounds and abilities. If you are an applicant with a disability that requires reasonable accommodation to complete the application process, please contact us at . At AECOM, we value everyone's unique contributions and perspectives. If you meet some of the requirements above or have transferable skills you believe would benefit us, we would be delighted to hear from you! Additional Information Interested in the role or curious about life at AECOM? Follow us on LinkedIn, Facebook, Instagram, and YouTube to explore our AECOM voices, employee stories, latest projects, and much more! For further information about the role, reach out to the recruiter on LinkedIn Jay Hewitt. About AECOM AECOM is the worlds trusted infrastructure consulting firm, delivering professional services throughout the project lifecycle from advisory, planning, design and engineering to program and construction management. On projects spanning transportation, buildings, water, new energy and the environment, our public- and private-sector clients trust us to solve their most complex challenges. Our teams are driven by a common purpose to deliver a better world through our unrivaled technical and digital expertise, a culture of equity, diversity and inclusion, and a commitment to environmental, social and governance priorities. AECOM is a Fortune 500 firm and its Professional Services business had revenue of $14.4 billion in fiscal year 2023. See how we are delivering sustainable legacies for generations to and @AECOM. Freedom to Grow in a World of Opportunity You will have the flexibility you need to do your best work with hybrid work options.Whether youre working from an AECOM office, remote location or at a client site, you will be working in a dynamic environment where your integrity, entrepreneurial spirit and pioneering mindset are championed. You will help us foster a safe and respectful workplace, where we invite everyone to bring their whole selves to work using their unique talents, backgrounds and expertise to create transformational outcomes for our clients. AECOM provides a wide array of compensation, benefits and well-being programs to meet the diverse needs of our employees and their families. Were the worlds trusted global infrastructure firm, and were in this together your growth and success are ours too. Join us, and youll get all the benefits of being a part of a global, publicly traded firm access to industry-leading technology and thinking and transformational work with big impact and work flexibility.As an Equal Opportunity Employer, we believe in each persons potential, and well help you reach yours. We are aDisabilityConfidentEmployer and will offer an interview to applicants who have a disability or long-term condition, who meet the minimum/essential criteria for the role. Please let us know using this email address if you would like to apply through theDisabilityConfidentInterview Scheme. All your information will be kept confidential according to EEO guidelines.

Job ID: 303895 Date posted: 18/08/2025 Are you a team player with a passion for food and people? Do you know your meat ball from your plant ball? If so, then we are looking for you. IKEA Belfast are looking to welcome Co-workers to join our hardworking Bistro & Swedish Food Market team who provide our customers many reasons to return to IKEA. Our Bistro & Swedish Food Market is our customers last stop before they leave, they can grab a quick snack to go or pick up some of our fantastic products to make at home. If you love taking responsibility and working in a fast-paced environment this is the job for you. In the IKEA world, we call this position an IKEA Food Co-worker. WHAT WE OFFER Start with us in September 2025 £12.60 per hour, permanent contracts with advanced scheduling 16 & 20 hour contracts available Flexibility will be discussed at interview, but evenings and weekend working will be expected We operate 7 days a week to meet the shopping needs of our customers Due to Health & Safety regulations, applicants must be over the age of 18. WORKING WITH US HAS ITS REWARDS Our co-workers bring unique ideas and talent to work every day, and we offer a variety of benefits that suit their and their family's everyday needs. Enjoy a free hot or cold meal option every shift - there is such a thing as a free lunch! 15% co-worker discount & I-Benefits discount portal helping you save €100s on High-street retailers End of year gift WHAT YOU'LL NEED TO HAVE Prior Fast Food experience is a plus. Ability to work in an extremely fast-paced environment. Be Self-reliant and motivated, ready to work independently and as part of our team. Ability to remain organised and detail-orientated, even when things get busy. Our ideal candidate is passionate and friendly with a roll up your sleeve mindset to work alongside the team and delivery a great customer experience. WHAT YOU'LL BE DOING DAY TO DAY These roles will involve a variety of tasks, where you will be required to serve food, take payment at tills, clean your work area and assist customers in the Swedish Food Market. Customer focused, by working together to create the best customer experience. Listen, act, and exceed their expectations every day. Ensure all safety protocols and regulations are followed for a secure environment for both our customers and co-workers. Support your colleagues, lend a hand, and create a positive work environment, contributing to a proud team. WE CARE FOR THE PEOPLE It takes the diversity of thought, background, and culture to make great ideas a reality. We welcome candidates from all walks of life, including those with disabilities, to join us as valued members of the team. We are an equal opportunities employer. Come see the wonderful workday where we create a better everyday life for the many RECRUITMENT PROCESS INFORMATION We are an equal opportunities employer. If you have any special requirements during the interview process, please let us know as soon as possible. Please attach an updated CV with your application so we can get to know you better. Shortlisted candidates will be invited by email to attend a face-to-face interview. Come see things a little differently with us and be part of creating a better everyday life for the many. We are unable to accept applications made via email and encourage you to apply online as soon as possible. For any advice or support, email and I will be happy to help!

JOB DESCRIPTIONJOB TITLE:General Assistant 1 (Special Needs)REPORTS TO:The Principal through class teacherJOB PURPOSETo be responsible to the Principal for the provision of assistance to teachers/classroom assistants in/outside school with care of pupils.MAIN DUTIES AND RESPONSIBILITIESGENERAL ASSISTANCE • Assist pupils with toileting/personal hygiene/dressing including the use of basic toileting aids., • Ensure the safe mobility and general supervision of the pupil/s within school premises including the playground and on school outings transporting pupils belongings (if required)., • Accompany teachers classroom assistants and/or therapy staff with groups on outings or in respect of individual/group therapy programmes e.g. swimming educational outings hydrotherapy etc., • Ensure appropriate care and feeding of pupils at meal times., • Ensure pupils comply with normal school rules and routines during the school day., • Clean equipment connected with daily activities in classroom and assist with setting out equipment as directed., • Such other duties as may be assigned within the level of the post. Those duties should be non-curricular.GENERAL CONDITIONS, • Carry out all duties to comply with:(a)the Health and Safety at Work (NI) order 1978;(b)Acts of Parliament Statutory Instruments and Regulations and other legal requirements;(c)Codes of Practice.Carry out all duties in the working conditions normally inherent in the particular job., • Complete all necessary paperwork., • You must clearly demonstrate on your application form under each question how and to what extent you meet the required criteria as failure to do so may result in you not being shortlisted. You should clearly demonstrate this for both the essential and desirable criteria where relevant., • You must demonstrate how you meet the criteria by the closing date for applications unless the criteria state otherwise., • The stage in the process when the criteria will be measured is outlined in the table below., • Shortlisting will be carried out on the basis of the essential criteria set out in Section 1 below using the information provided by you on your application form., • Please note that the Selection Panel reserves the right to shortlist only those applicants that it believes most strongly meet the criteria for the role. FactorEssential CriteriaMethod of Assessment Experience Have a minimum of three months experience of working with a child/children in a formal environment ie school nursery or playgroup Demonstrable experience in one or more of the following areas: • Providing direct support to a child/children in a formal environment ie school nursery or playgroup Knowledge Demonstrable knowledge of the requirements of a General Assistant 1 (Special Needs) Shortlisting by Application Form Other Willingness to undertake job related training as and when required. Shortlisting by Application Form SECTION 2 - ESSENTIAL CRITERIA FactorEssential CriteriaMethod of Assessment Knowledge Demonstrable knowledge of: • Child Protection and Safeguarding as relevant to the role Evidence of effective interpersonal and communication skills Proven effective team working skills Evidence of good planning and organising skills to ensure work is completed on time to the required standard Interview Values Orientation Evidence of how your experience and approach to work reflect the schools values/ethos. You will find information about the schools values/ethos on our school website Interview___ SECTION 3 - DESIRABLE CRITERIA FactorDesirable CriteriaMethod of Assessment Experience / Knowledge Evidence of a working knowledge of one or more of the following IT systems: • Microsoft Word and Outlook ___JOB DESCRIPTIONJOB TITLE:General Assistant 1 (Special Needs)REPORTS TO:The Principal through class teacherJOB PURPOSETo be responsible to the Principal for the provision of assistance to teachers/classroom assistants in/outside school with care of pupils.MAIN DUTIES AND RESPONSIBILITIESGENERAL ASSISTANCE • Assist pupils with toileting/personal hygiene/dressing including the use of basic toileting aids., • Ensure the safe mobility and general supervision of the pupil/s within school premises including the playground and on school outings transporting pupils belongings (if required)., • Accompany teachers classroom assistants and/or therapy staff with groups on outings or in respect of individual/group therapy programmes e.g. swimming educational outings hydrotherapy etc., • Ensure appropriate care and feeding of pupils at meal times., • Ensure pupils comply with normal school rules and routines during the school day., • Clean equipment connected with daily activities in classroom and assist with setting out equipment as directed., • Such other duties as may be assigned within the level of the post. Those duties should be non-curricular.GENERAL CONDITIONS, • Carry out all duties to comply with:(a)the Health and Safety at Work (NI) order 1978;(b)Acts of Parliament Statutory Instruments and Regulations and other legal requirements;(c)Codes of Practice.Carry out all duties in the working conditions normally inherent in the particular job., • Complete all necessary paperwork., • You must clearly demonstrate on your application form under each question how and to what extent you meet the required criteria as failure to do so may result in you not being shortlisted. You should clearly demonstrate this for both the essential and desirable criteria where relevant., • You must demonstrate how you meet the criteria by the closing date for applications unless the criteria state otherwise., • The stage in the process when the criteria will be measured is outlined in the table below., • Shortlisting will be carried out on the basis of the essential criteria set out in Section 1 below using the information provided by you on your application form., • Please note that the Selection Panel reserves the right to shortlist only those applicants that it believes most strongly meet the criteria for the role. FactorEssential CriteriaMethod of Assessment Experience Have a minimum of three months experience of working with a child/children in a formal environment ie school nursery or playgroup Demonstrable experience in one or more of the following areas: • Providing direct support to a child/children in a formal environment ie school nursery or playgroup Knowledge Demonstrable knowledge of the requirements of a General Assistant 1 (Special Needs) Shortlisting by Application Form Other Willingness to undertake job related training as and when required. Shortlisting by Application Form SECTION 2 - ESSENTIAL CRITERIA FactorEssential CriteriaMethod of Assessment Knowledge Demonstrable knowledge of: • Child Protection and Safeguarding as relevant to the role Evidence of effective interpersonal and communication skills Proven effective team working skills Evidence of good planning and organising skills to ensure work is completed on time to the required standard Interview Values Orientation Evidence of how your experience and approach to work reflect the schools values/ethos. You will find information about the schools values/ethos on our school website Interview SECTION 3 - DESIRABLE CRITERIA FactorDesirable CriteriaMethod of Assessment Experience / Knowledge Evidence of a working knowledge of one or more of the following IT systems: • Microsoft Word and Outlook

Senior Frontend Engineer - TypeScript / React + AWS Location: Belfast (Remote, UK-based) Reference: OCHO-SFE0425 OCHO - Building Teams The Opportunity We're partnered with a fast-moving, product-led tech company headquartered in Belfast, building large-scale workflow solutions for some of the world's biggest enterprises. Their engineering culture is highly collaborative, modular, and cloud-native - and they're now hiring a Senior Frontend Engineer to take ownership of key UI initiatives across their modern platform. This is a role for an engineer who thrives in TypeScript ecosystems, understands the principles of cloud-first software, and is motivated by clean, scalable frontend architecture. You'll be contributing across the full engineering lifecycle - not just shipping UIs, but helping shape how the platform operates end-to-end. What You'll Be Doing Leading the design and development of React-based applications (Hooks, Context, TypeScript) within a monorepo environment Building scalable frontend solutions integrated with AWS services and serverless APIs Championing frontend code quality, performance, accessibility, and reusability - including component libraries (e.g. Storybook) Mentoring engineers and guiding best practices in testing (Jest, Cypress), CI/CD, and frontend observability Collaborating with platform teams on core decisions around authentication, analytics, real-time events, and PWA optimisation Working closely with DevOps and backend engineers in a CI/CD-driven environment (GitHub Actions, Terraform, ArgoCD, etc.) What We're Looking For 6+ years of commercial software experience, including delivering React + TypeScript at scale Strong architectural background - you've built or scaled monorepos, component libraries, or complex frontend systems Hands-on experience with AWS - ideally Lambda, API Gateway, CloudFront, and S3 DevOps-aware mindset with experience in CI/CD, performance tuning, and deployment workflows A collaborative, mentoring approach with proven success in cross-functional teams Bonus: exposure to NestJS, GraphQL, WebSockets, or mobile/PWA delivery What's on Offer Competitive salary 25 days annual leave + public holidays Remote-first working with flexible hours 10% employer and 10% individual pension contribution Health and wellness programme Tech talks, team meetups, and L&D budget Clear career progression framework Interested? Reach out to Ryan Quinn directly on LinkedIn or submit your CV via the link to learn more. Skills: JavaScript AWS TypeScript

Job overview NB:InadditiontothesefunctionsemployeesarerequiredtocarryoutsuchotherdutiesasmaybereasonablyrequiredandtofollowallHRpoliciesandproceduresincludingtheEqual OpportunitiesandHealthCSafetypolicies.) ToplanandcarryoutdeliveriestoKewElectricalscustomers,soastomaintainanddeveloptheservicerelationshipwiththosecustomers,inaccordancewithagreedbusinessplans. Toensurestoresareaisstockedwithinguidelines;havingitemsstockcontrolledwithinAgathos system,clearlyidentified,binlocatedandstored/pickedinasafe/effectivemanner. Main responsibilities Driver Maintainasafeandeffectivemultidropdeliveryservicetoprofitcentrecustomers. Todriveinasafeandlawfulmanner,ensuringourbrandisnotbroughtintodisrepute. Planandmakedeliveriesperprofitcentrerequeststoensurebothfuelandmileage efficiency. Maintainacleanandsafevehicle,filingaweeklyvehiclechecksheettothe Divisional Secretary and reporting any necessary issues immediately. Respondtoenquiriesfromcustomersinapositiveandhelpfulmanner,referringtoyour profit centre as necessary. ReportanytrafficoffencesoraccidentstotheProfitCentreorDivisionalOffice immediately. Stores Toensurestockarrivingatwarehouseisaccepted,signedforandenteredintothestock control system in a timely manner. Toreportbreakagesand/ormissingitemstothesupplierassoonaspossiblefromany delivery. Toputawaystockinatimelyandsafemanner,usingforklifttruckwherenecessaryand only when trained to do so. Toensurethatordersreceivedintothedepartmentarepickedaccuratelyagainstthe documentation, packedeffectively and anymissing items, shortages or inaccessible items are identified to department team leader/manager. Toensureinterprofitcentretransfersaredealtwithinaneffectivemanner,ensuringthey are ready for collection from link van drivers. Tochaseanysupplierthathasnotcollectedreturnsinatwo-monthperiod. Toassistinthepreparationandcountprocessforanycompanystocktake. To maintain a tidy, safe and manageable working environment, adhering to all safe workingpractises,ensuringanyaccidentsornearmissesarereportedtothe PCM/or Divisional Office immediately. Skills and Experience Valid clean driving license Strong communication skills Previous stores experience preferably within electrical wholesale environment Strong understanding of stores, goods inwards processes Knowledge of computerised storage systems Within this role you will be expected to have and be able to Follow established store and delivery procedures (routine tasks). Work independently with periodic reviews by the Profit Centre Manager. Ensure safe handling and protection of goods in transit and storage. Liaise with internal staff at Kew. Regularly interact with delivery companies and customers. Professional appearance when representing the company. Flexibility to work outside normal hours when required. Closing date - 18th September 2025 Skills: Driver Stores Person Benefits: Pension Scheme Profit Share Scheme

We re looking for a Kitchen Assistant who s great at supporting chefs prepping food and keeping things clean and organised. If you re hands-on reliable and enjoy being part of a busy kitchen team we d love to hear from you. Key Responsibilities: • Assist chefs and other kitchen staff during meal preparation., • Prepare ingredients and assist with basic food prep., • Maintain cleanliness and sanitation of kitchen areas and utensils., • Stock and organize supplies monitor inventory levels., • Follow safety and hygiene standards always., • Support during busy service hours as needed., • Ensure proper storage of ingredients., • Previous kitchen or food service experience., • Ability to work efficiently in a fast-paced environment., • Basic knowledge of food safety and hygiene., • Enthusiasm for learning new skills and techniques., • A genuine interest in food and presentation., • Physical stamina for standing and moving during shifts. Previous kitchen or food service experience. Ability to work efficiently in a fast-paced environment. Basic knowledge of food safety and hygiene. Enthusiasm for learning new skills and techniques. A genuine interest in food and presentation. Physical stamina for standing and moving during shifts. Key Skills Culinary Experience,Food Handling,Restaurant Experience,Food Preparation Experience,Food Service,Kitchen Experience,Hospitality Experience,Basic Math,Food Safety Experience,Retail Sales,Cooking,Sanitation Employment Type : Full Time Experience: years Vacancy: 1 Monthly Salary Salary: 12 - 13

Bar and Floor staff Dirty Onion Are you outgoing reliable and thrive in a fast-paced environment Were on the hunt for enthusiastic Bar & Floor Staff to join our energetic team at one of the Belfasts busiest and most vibrant bars. You will be responsible for: • Delivering outstanding customer service with a smile, • Maintaining a clean tidy and safe working environment, • Supporting your team through busy shifts, • Keeping cool under pressure and bringing energy to every shift, • Collecting and cleaning glassware to a good standard (floor positions), • Handling payments accurately and efficiently (bar positions), • Serving drinks efficiently and to a high standard (bar positions) We will only consider applications from those who are fully flexible to work late nights Friday and Saturday. What were looking for: • Floor staff - Previous bar experience preferred (6 months), • Bar staff Previous bar experience essential (6 months), • Good communicators with a passion for hospitality, • Strong work ethic and the ability to work well in a team, • Confidence working in a fast-paced high-volume venue This is an excellent opportunity to join the provinces largest operator of licensed premises. The Dirty Onion offers staff: • Company discount offering 20% off food in various outlets including Bullitt Hotel Little Wing Pizzeria The National and The Cloth Ear., • Flexible Working, • Up to 29days holiday, • Seasonal parties, • NVQs online and classroom training, • Distillery trips and brand events The rate of pay for this position is 12.21 per hour The Company reserves the right to apply an enhanced shortlist criteria. The Dirty Onion is part of the Beannchor Group and is an equal opportunities employer. #INDFS #Barstaff #Floorstaff #Bartender #Glasscollector Key Skills Culinary Experience,Restaurant Experience,Succession Planning,Customer Service,Hospitality Experience,Guest Relations Experience,Management Experience,Serving Experience,Shift Management,Computer Literacy,Restaurant Management,Stocking Employment Type : Full-Time Experience: years Vacancy: 1

About Us: We are the leader in human-centric cybersecurity. Half a million customers including 87 of the Fortune 100 rely on Proofpoint to protect their organizations. Were driven by a mission to stay ahead of bad actors and safeguard the digital world. Join us in our pursuit to defend data and protect people. How We Work: At Proofpoint youll be part of a global team that breaks barriers to redefine cybersecurity guided by our BRAVE core values: Bold in how we dream and innovate Responsive to feedback challenges and opportunities Accountable for results and best-in-class outcomes Visionary in future-focused problem-solving Exceptional in execution and impact. Corporate Overview Proofpoint is a leading cybersecurity company protecting organizations greatest assets and biggest risks: vulnerabilities in people. With an integrated suite of cloud-based solutions Proofpoint helps companies around the world stop targeted threats safeguard their data and make their users more resilient against cyber-attacks. Leading organizations of all sizes including more than half of the Fortune 1000 rely on Proofpoint for people-centric security and compliance solutions mitigating their most critical risks across email the cloud social media and the web. We are singularly devoted to helping our customers protect their greatest assets and biggest security risk: their people. Thats why were a leader in next-generation cybersecurity. Protection Starts with People. Proofpoint. The Role Proofpoint is looking for a Machine Learning Scientist to join the Algo team within the Tessian Business this role your key responsibility will be to analyse data build ML models and improve algorithms at the core of our email threat detection engine that protects some of the largest businesses in the world. You will collaborate with Product and Engineering teams to identify and solve the most impactful problems applying state-of-the-art machine learning tools and techniques. Youll be surrounded by incredibly smart talented and friendly colleagues. Engineers at Tessian love to learn from each other and pull together as a team to succeed. *This is a Hybrid role; Cork or Belfast. Your day-to-day -Wrangle and draw meaningful insights from massive amounts of unstructured textual data using the latest tools and technologies like Spark Iceberg Athena AWS SageMaker -Apply unsupervised learning algorithms across billions of email interactions to identify emerging threat patterns -Work with state-of-the-art machine learning models and techniques like encoder-decoder transformers LLMs anomaly detection as well as classical ML models to solve a multifaceted problem -Engineer new features train and deploy models to production using AWS SageMaker as the MLOps platform -Adopt a data-driven approach to identify gaps in our detection algorithms and propose improvements to our models and algorithms -Promote and drive ML best practices and cultivate an environment of experimentation and learning -Stay up to date with the latest advancements in machine learning AI technologies and incorporate them into our solutions where applicable What you bring to the team Essential • Proficiency in Python with the ability to write clean well-structured and maintainable code for data analysis modeling and experimentation, • Experience contributing to multiple highly impactful machine learning projects with proven results -Hands-on experience in the NLP domain involving training fine-tuning and productionising transformer-based models for text classification / text-embeddings (experience with LLMs generative AI is a plus) -Experience monitoring and maintaining performance of models over time in production considering model/data drifts In-depth experience with one or more deep neural network frameworks (e.g. PyTorch Tensorflow JAX) -A creative mindset propensity to care deeply about the impact their team has and to encourage novel ways of critical thinking in their team Good to have -Conceptual understanding of Graph Neural Networks and experience applying GNNs to solve real world problem statements will be a plus -Experience working on large imbalanced datasets evaluating and selecting models that work well in production on imbalanced real-world data Why Proofpoint Protecting people is at the heart of our award-winning lineup of cybersecurity solutions and the people who work here are the key to our success. Were a customer-focused and a driven-to-win organization with leading-edge products. We are an inclusive diverse multinational company that believes in culture fit but more importantly culture-add and we strongly encourage people from all walks of life to apply. We believe in hiring the best and the brightest to help cultivate our culture of collaboration and appreciation. Apply today and explore your future at Proofpoint! #LifeAtProofpoint #LI-Hybrid Why Proofpoint At Proofpoint we believe that an exceptional career experience includes a comprehensive compensation and benefits package. Here are just a few reasons youll love working with us: Competitive compensation Comprehensive benefits Learning & Development: We are committed to the growth and development of our team members offering a range of programs including leadership and professional development workshops stretch project assignments and mentoring opportunities to help employees reach their full potential. Flexible work environment: Remote options hybrid schedules flexible hours etc.. Annual wellness and community outreach days Always on recognition for your contributions Global collaboration and networking opportunities Our Culture: Our culture is rooted in values that inspire belonging empower purpose and drive success-every day for everyone. We encourage applications from individuals of all backgrounds experiences and perspectives. If you need accommodation during the application or interview process please reach out to _________Our culture is rooted in values that inspire belonging empower purpose and drive success-every day for everyone. We encourage applications from individuals of all backgrounds experiences and perspectives. If you need accommodation during the application or interview process please reach out to About Us: We are the leader in human-centric cybersecurity. Half a million customers including 87 of the Fortune 100 rely on Proofpoint to protect their organizations. Were driven by a mission to stay ahead of bad actors and safeguard the digital world. Join us in our pursuit to defend data and protect people. How We Work: At Proofpoint youll be part of a global team that breaks barriers to redefine cybersecurity guided by our BRAVE core values: Bold in how we dream and innovate Responsive to feedback challenges and opportunities Accountable for results and best-in-class outcomes Visionary in future-focused problem-solving Exceptional in execution and impact. Corporate Overview Proofpoint is a leading cybersecurity company protecting organizations greatest assets and biggest risks: vulnerabilities in people. With an integrated suite of cloud-based solutions Proofpoint helps companies around the world stop targeted threats safeguard their data and make their users more resilient against cyber-attacks. Leading organizations of all sizes including more than half of the Fortune 1000 rely on Proofpoint for people-centric security and compliance solutions mitigating their most critical risks across email the cloud social media and the web. We are singularly devoted to helping our customers protect their greatest assets and biggest security risk: their people. Thats why were a leader in next-generation cybersecurity. Protection Starts with People. Proofpoint. The Role Proofpoint is looking for a Machine Learning Scientist to join the Algo team within the Tessian Business this role your key responsibility will be to analyse data build ML models and improve algorithms at the core of our email threat detection engine that protects some of the largest businesses in the world. You will collaborate with Product and Engineering teams to identify and solve the most impactful problems applying state-of-the-art machine learning tools and techniques. Youll be surrounded by incredibly smart talented and friendly colleagues. Engineers at Tessian love to learn from each other and pull together as a team to succeed. *This is a Hybrid role; Cork or Belfast. Your day-to-day -Wrangle and draw meaningful insights from massive amounts of unstructured textual data using the latest tools and technologies like Spark Iceberg Athena AWS SageMaker -Apply unsupervised learning algorithms across billions of email interactions to identify emerging threat patterns -Work with state-of-the-art machine learning models and techniques like encoder-decoder transformers LLMs anomaly detection as well as classical ML models to solve a multifaceted problem -Engineer new features train and deploy models to production using AWS SageMaker as the MLOps platform -Adopt a data-driven approach to identify gaps in our detection algorithms and propose improvements to our models and algorithms -Promote and drive ML best practices and cultivate an environment of experimentation and learning -Stay up to date with the latest advancements in machine learning AI technologies and incorporate them into our solutions where applicable What you bring to the team Essential • Proficiency in Python with the ability to write clean well-structured and maintainable code for data analysis modeling and experimentation, • Experience contributing to multiple highly impactful machine learning projects with proven results -Hands-on experience in the NLP domain involving training fine-tuning and productionising transformer-based models for text classification / text-embeddings (experience with LLMs generative AI is a plus) -Experience monitoring and maintaining performance of models over time in production considering model/data drifts In-depth experience with one or more deep neural network frameworks (e.g. PyTorch Tensorflow JAX) -A creative mindset propensity to care deeply about the impact their team has and to encourage novel ways of critical thinking in their team Good to have -Conceptual understanding of Graph Neural Networks and experience applying GNNs to solve real world problem statements will be a plus -Experience working on large imbalanced datasets evaluating and selecting models that work well in production on imbalanced real-world data Why Proofpoint Protecting people is at the heart of our award-winning lineup of cybersecurity solutions and the people who work here are the key to our success. Were a customer-focused and a driven-to-win organization with leading-edge products. We are an inclusive diverse multinational company that believes in culture fit but more importantly culture-add and we strongly encourage people from all walks of life to apply. We believe in hiring the best and the brightest to help cultivate our culture of collaboration and appreciation. Apply today and explore your future at Proofpoint! #LifeAtProofpoint #LI-Hybrid Why Proofpoint At Proofpoint we believe that an exceptional career experience includes a comprehensive compensation and benefits package. Here are just a few reasons youll love working with us: Competitive compensation Comprehensive benefits Learning & Development: We are committed to the growth and development of our team members offering a range of programs including leadership and professional development workshops stretch project assignments and mentoring opportunities to help employees reach their full potential. Flexible work environment: Remote options hybrid schedules flexible hours etc.. Annual wellness and community outreach days Always on recognition for your contributions Global collaboration and networking opportunities Our Culture: Our culture is rooted in values that inspire belonging empower purpose and drive success-every day for everyone. We encourage applications from individuals of all backgrounds experiences and perspectives. If you need accommodation during the application or interview process please reach out to

Key Responsibilities • Develop and maintain core data pipelines supporting FX BAU and small enhancement projects, • Collaborate with cross-functional teams to deliver high-impact data solutions, • Contribute to both strategic initiatives and day-to-day operations, • Work independently and as part of a team to manage multiple priorities and context-switch effectively, • Engage with Front Office stakeholders and datasets particularly within FICC asset classes Qualifications : Tech stack • Proficiency in Python: Solid experience writing clean efficient and scalable Python code., • Data Manipulation with Pandas: Strong understanding of dataframes data cleaning transformation and analysis using the Pandas library., • Software Development Life Cycle (SDLC): Demonstrated experience working across all phases of the SDLC including requirements gathering design development testing deployment and maintenance., • Familiarity with version control systems (e.g. Git) and CI/CD pipelines., • Self-starter with excellent organisational skills, • Comfortable working independently and collaboratively, • Proven ability to manage multiple initiatives simultaneously, • Experience in fast-paced environments with shifting priorities, • Front Office experience particularly in FICC asset classes, • Exposure to FX datasets and trading environments, • Familiarity with agile methodologies and project delivery Additional Information : A little background on DI Simply put we turn big data problems into smart data solutions At our core Data Intellect is a data and technology consultancy firm. Our key area of expertise is financial and capital markets technology solutions. However the utility of these solutions allow us to apply fintech data expertise to other industries such as smart energy and healthcare. This proprietary offering is complemented by a wealth of experience in data engineering electronic trading systems data capture applications regulatory and compliance systems and middle and back-office enterprise web solutions. Fair employment and equal opportunities Data Intellect is an equal opportunity employer. We celebrate diversity and are committed to creating an inclusive environment for all employees. Accommodations are available on request throughout the assessment and selection process. Welcome to Data Intellect. #ChallengeAccepted Remote Work : No Employment Type : Contract Key Skills Apache Hive,S3,Hadoop,Redshift,Spark,AWS,Apache Pig,NoSQL,Big Data,Data Warehouse,Kafka,Scala Experience: years Vacancy: 1

From our Head Office to the shop floor and everywhere in between our primary goal is to create and deliver a fantastic customer journey for everyone who shops at Lidl. Customer obsessed high energy and love learning every day If that sounds like you earn 370 per week as a Customer Assistant on our standard 30 hour contract. Your role will be varied working across different shift times tasks and with different colleagues. What does a normal day* as a Customer Assistant look like (*theres no such thing as normal in retail but weve tried our best!) As a Customer Assistant you are required to sell alcohol therefore you must be 18 or over to work in our store. Shift Patterns: • Morning shift: Starting at 5am or 6am with your team youll be getting our award-winning products fully stocked on the shop floor and our delicious bakery products ready for our customers to enjoy by opening time so they can Go Full Lidl!, • Middle shift:Starting mid-morning or early afternoon youll make sure our stores are spotlessly clean well presented and our products remain fresh all while helping customers with queries on the shop floor and working on tills to minimise till queues, • Late shift:From your start time in the afternoon youll make sure our customers experience is top class by serving them with a smile while on the tills restocking missing items and getting the store ready for the next day, • Interacting with the customer in a pleasant friendly and helpful manner, • Ensuring stock loss controls are followed in all areas of the store, • Maintaining store and external cleanliness and hygiene standards, • Following freshness and rotation principles, • Ensuring all waste is managed correctly, • Assisting in the stock count process, • A can-do attitude and excellent customer service skills, • The willingness to go the extra mile for our customers, • To be responsible and reliable, • To enjoy working in a fast-paced varied environment, • A good team player, • 12.40 per hour rising to 14.10 per hour after 3 years, • Additional supplements paid depending on the days & hours worked*, • 29 days holidays per annum (pro rata including Bank Holidays), • Company pension after 1 year, • Genuine opportunities for career development, • Individuals recognised as high performing will be invited to join our Leadership Academy as part of your on-going development, • Mobile and broadband discounts with Vodafone, • Generous discounts available; Circle K Bike to Work, • Basic Rate 12.40, • 15.50 (Unsocial Hours), • Basic Rate 12.80, • 16.00 (Unsocial Hours), • Basic Rate 13.40, • 16.75 (Unsocial Hours), • Basic Rate 14.10, • 17.63 (Unsocial Hours) Key Skills Time Management,Sourcing,Talent Acquisition,Taleo,ATS,HR Sourcing,Interviewing,Management Experience,Team Management,Human Resources,negotiation,Recruiting Employment Type : Part-Time Experience: years Vacancy: 1

JOB TITLE: LOAN OFFICER SUMMARY OF ROLE Reporting directly to the Lending Manager, the successful candidate will be responsible for processing loan applications for Members while providing excellent customer service and promoting CCU loan products and services that are tailored to the individual. RESPONSIBLE TO Lending Manager assisted by the Branch Area Manager. HOURLY RATE £13.10 KEY RESPONSIBILITIES Create and build a rapport with the Member and providing excellent customer service both face to face and over the phone when taking loan applications. Offering a range of services available. Dealing with and resolving Member queries when required. Follow company policies and procedures in line with Loan Officer duties. Ensuring the correct documentation is collected, processed and uploaded to progress, e.g., POID and POA. Loan applications. Income and expenditure. Ensuring all data is recorded correctly and securely on progress. Ensure proof of income is collected when required, record accurately ALL information gathered from members, ensuring data input and notes are a true and factual record of information obtained on all applications. Assess loan applications and all other loan related matters by all means of communication in an orderly and compliant manner, within your lending authority. Refer / defer loans to the Lending Team daily. Responsible for the delivery of all loan decisions, delivering all decisions to members verbally and face to face with a duty of care and sensitivity. Daily admin duties including: Scanning Filing Complete all relevant training when required. Assisting with Cashier duties in line with business need and on request. Completing membership applications as per membership policy. Any other duties as directed by management team. The above is not an exhaustive list of duties and you will be expected to perform different tasks as necessitated by your changing role within the organisation and the overall business objectives of the organisation. EXPERIENCE ESSENTIAL Minimum of 5 GCSEs (including English and Maths) or equivalent. Previous experience in financial services, banking, or customer service roles. Understanding of financial products, loan types, and relevant regulations. Awareness of GDPR, anti-money laundering (AML) Strong attention to detail and accuracy. Excellent interpersonal and communication skills (verbal and written). Good numerical and analytical ability. Problem-solving and decision-making skills. Proficiency in IT systems, databases, and MS Office (especially Excel). Full clean driving licence and access to own car must be able to travel between branches. DESIRABLE Experience in loan processing, underwriting, or credit assessment Ability to interpret credit reports and apply lending criteria. Understanding of risk management and responsible lending. Experience handling confidential or sensitive information. ESSENTIAL SKILL SET Integrity and discretion. Professional and trustworthy demeanour. Ability to communicate clearly and professionally with stakeholders at all organisational levels. Motivated, proactive, and results-driven. Comfortable working under pressure and meeting deadlines. Flexible and be able to respond to changing business requirements, can do attitude.

Room Attendant, Malmaison Rate of Pay £12.50 / 16 Hours per week & 32 Hours per week Type of Contract: Permanent Location: Belfast Working as part of the Housekeeping team you will ensure all guest bedrooms within the hotel are cleaned on a daily basis to the highest of standards. You will have an eye for detail and naturally high standards to meet our guests expectations of a perfect nights stay. Malmaison provide a range of luxury and boutique hotels in 15 landmark locations around the United Kingdom. Synonymous with style and hospitality, Malmaison offers exquisite accommodation with a relaxing atmosphere throughout our chain of hotels along with sumptuous food and wine in our trademark Chez Mal Brasseries. Working as a Room Attendant you will be interacting with our Guests so conversational English is essential, as is the ability to work on your own for periods of time. You will be a vital cog in the Malmaison machine ensuring all bedrooms are clean and tidy for our guests arrival and continued stays. Need flexibilityYou will predominantly work set shifts, usually between 9am 3pm, 5 days out of 7. Shift start times can be flexible between 9am 10am. If desired earlier start times can be discussed at interview as well as flexible contracts or just weekend work. Being a Room Attendant is hard work and will require a level of fitness in order to complete this vital role. Full training in the use of chemicals and equipment will be provided. Experience in a similar role isn't required but a positive attitude and desire to make a difference within the hotel is essential. We actively encourage internal development and progression and Malmaison is on target to have 100 new apprentices in the business by year end. Candidates for this position would be given the opportunity to enroll on our apprenticeship scheme after they have completed their probationary period. IND1 In addition to competitive rates of pay we offer: Heavily discounted Staff Room Rates at Malmaison, Hotel du Vin and Frasers Hospitality with rooms available from £65 per night. Discounted Friends and Family Room Rate with 50% off best available rate. 35% off your bill when you dine in our Brasseries and Bistros Fully funded Apprenticeship programmes that support you in developing your career High Street Discounts on a range of high street shops, experiences, holidays and much much more Cycle to work scheme save up to 40% on a wide range of bikes Healthcare Cash Plans - dental, optical, medical and more available from £5 per month Referral schemes that pay up to £1500 (just for getting your mates jobs!) A decent uniform that doesnt make you look like an extra from a 70s TV sitcom. We have a Wellness & National Campaign Days Calendar which promotes and encourages activities like Pay Day Lunches/Treats, National Popcorn Day, Mental Health Awareness week and more We work with Wagestream giving instant access to your pay as its earnt. Wagestream is a tool for everyday life that lets you get paid your way by letting you track your wages in real time, stream up to 50% of the money youre already earned, learn easy tips to manage your money better and save direct from your salary We also offer complimentary stays on your 1st, 3rd and 5th anniversary with Dinner, Bed & Breakfast We are a proud sponsor of The Brain Charity , helping people with all forms of neurological conditions to lead longer, healthier, happier lives. Employee Assistance Programme free, confidential advice available 24/7 to you and your family Our Sustainability Goals: 100% of our electricity is generated using renewable energy with most of it coming from Wind Farms around the UK We recycle a minimum of 70% of the waste from our hotels. This target is achieved by everyone I the hotel focusing on the waste we produce and is championed by our Sustainability Council who work on project year round We have moved to a chemical free cleaning system in our bedrooms and public areas and an enzyme based eco-friendly system for our kitchens. Volunteer to work for sustainable charities 2 days per year on full pay instead of your normal workplace Interested?? Click Apply Now Frasers Hospitality, Malmaison & Hotel Du Vin are an equal opportunities employer and welcome applications from all suitably qualified persons regardless of their race, sex, disability, religion/belief, sexual orientation or age.

• Dishwashing Wash dishes utensils and kitchen equipment either by hand or using industrial dishwashers, • Kitchen Cleanliness Clean and sanitise kitchen surfaces countertops and food preparation areas. Empty rubbish bins and ensure proper disposal of waste materials, • Food Preparation Assist chefs and cooks with basic food preparation tasks such as peeling chopping and slicing ingredients, • Inventory Management Assist in receiving storing and organising kitchen supplies and ingredients, • Compliance with Health and safety maintain cleanliness and organisation of the kitchen ensuring equipment is in good working order, • Delivery of Corporate Hospitality to Regional Locations Qualifications : • No formal education is required but a high school diploma or equivalent may be preferred, • Physical stamina and the ability to stand for extended periods and lift heavy objects, • Good attention to detail and the ability to follow instructions, • Basic knowledge of kitchen equipment and sanitation practices is a plus, • Strong communication and teamwork skills Additional Information : For almost 20 years for every client in every location (whether thats an office stadium cathedral or university) we have created beautiful spaces exciting menus and friendly teams so that each and every customer can have the hospitality experience they deserve. We need the brightest and the best to join us to make this all possible. We will support you to create your hospitality legacy and build a career that you are proud of. Our drive and belief in our people means that we always strive to supercharge our teams careers. Better is a daily habit that sits deep within our DNA meaning learning will be front and centre of your experience working with us. Join us and be part of the food revolution! BaxterStorey Values: ALWAYS VISIONARY We strive for better we never settle never compromise never follow. We lead the way blazing our own trail. WHOLEHEARTEDLY POSITIVE We are up-beat motivating and inspiring. Our love for what we do radiates through our food and is amplified by our people. CREATIVELY COLLABORATIVE We embrace our differences to push creativity and we work together to be better. FOREVER CONSCIOUS We work together as a team to lead by example protecting the planet and supporting local communities. Interested Even if you dont meet all requirements wed like to hear from you. If you are motivated and hungry to learn we can work together to develop your potential. We are proud to be an inclusive employer and welcome applications from candidates of all backgrounds. We celebrate individuality and are committed to creating an inclusive environment for all employees. We encourage applications from people of all ages abilities gender identities sexual orientations races religions and socio-economic backgrounds. BaxterStorey is committed to encouraging equity diversity and inclusion (ED&I) among our workforce and aim for our workforce to be truly representative of all sections of society and for each employee to feel respected and able to give their best. To support our commitment to this we have set ourselves an ambition to set the standard and to be recognised for having the most inclusive culture in hospitality. Join us and bring your unique perspective to our team. Remote Work : No Employment Type : Full-time Key Skills Restaurant Experience,Talent Management,Customer Service,Communication skills,Basic Math,Box Truck Experience,Commercial Driving,Delivery Driver Experience,Driving,Heavy Lifting,Cash Handling,Writing Skills Experience: years Vacancy: 1

As a Senior kdb Developer at DI youll be at the forefront of delivering high-performance scalable solutions for some of the worlds most data-intensive financial institutions. Youll: • Lead technical delivery on client projects setting the standard for quality and performance., • Design and implement robust kdb architectures that handle billions of rows of time-series data., • Collaborate with quants traders and analysts to translate business needs into performant efficient code., • Mentor and guide junior and mid-level developers fostering a culture of technical excellence., • Own the full development lifecycle by developing testing supporting and maintaining all code for client applications, • Drive innovation by staying ahead of the curve in kdb q and adjacent technologies. Qualifications : What You Bring • 5 years of hands-on kdb development with deep expertise in q and time-series data., • Proven experience designing and implementing kdb architectures and scaling kdb systems in production., • Strong background in Unix/Linux environments and scripting., • Demonstrated technical leadership and decision-making in fast-paced projects., • Excellent communication skillsyou can explain complex systems to both technical and non-technical stakeholders., • Experience in capital markets or investment bankingyou understand the domain and its demands., • Experience with Python cloud platforms (AWS GCP Azure) or other time-series databases., • Exposure to tick data real-time analytics or electronic trading systems., • People management or team leadership experience. Additional Information : Why Join Data Intellect • Hybrid & flexible working balance your time between home and our global offices., • Global opportunities work with clients in London New York Hong Kong Singapore and beyond., • Continuous learning access to paid training certifications and leadership development., • Clear progression paths biannual promotion cycles and regular 1:1s to support your growth., • Healthcare & wellbeing provider dependent on region. Data Intellect is a specialist data and technology consultancy with deep roots in capital markets. We build high-performance systems that power trading risk and analytics for some of the worlds most demanding clients. Our expertise spans kdb data engineering regulatory tech and enterprise platforms and were growing fast. Fair Employment & Equal Opportunities Were proud to be an equal opportunity employer. We celebrate diversity and are committed to creating an inclusive environment for all employees. Accommodations are available throughout the assessment and selection process. Ready to lead the next generation of kdb solutions Challenge Accepted. Apply now. Remote Work : No Employment Type : Full-time Key Skills APIs,REST,Spring,SOAP,.NET,React,Node.js,Angular,J2EE,JavaScript,Web Services,Java Experience: years Vacancy: 1

Stora is a self storage software platform at the forefront of a technology-led revolution in the industry. We empower self storage operators to seamlessly manage their businesses automate processes and drive revenue just over 4 years weve helped hundreds of operators around the world process tens of millions in automated payments. Known as innovators in our space were a fast-growing team focused on making self storage better for everyone. Were hiring a Data Operations Analyst to help fuel our sales engine. The sales team is growingand they need the right data cleanly prepared in the right places. Youll be responsible for sourcing refining and maintaining lead data to support our outbound and inbound sales efforts. Your work directly helps our BDRs and Account Executives focus on what matters: having great conversations and closing deals. This is an ideal entry point for someone analytical detail-oriented and eager to get hands-on with real-world data workflows. Youll play a key role in supporting our go-to-market teams and helping shape how we scale sales at Stora. For the right person this role offers a clear path to grow within the companywith the potential to progress into high-impact roles and earn a six-figure salary within a few years. * Research and compile high-quality lead lists across UK and European markets * Enrich and clean company and contact data to meet sales team criteria * Work closely with the BDR team to deliver lists that are ready to use * Use Hubspot and spreadsheets to manage data * Spot patterns or issues in lead data and propose improvements * Collaborate with Marketing to align on targeting and campaign data * Maintain data accuracy in HubSpot and other sales systems * Create simple workflows or trackers to keep lead management smooth * A degree in a quantitative field like Economics Mathematics Engineering or a related discipline is idealbut were open to candidates with strong analytical skills from other backgrounds. * Analytical mindset and attention to detailyou spot errors and fix them * Comfortable working in spreadsheets and navigating data tools * Strong written communication skills * Curious and methodicalsomeone who likes researching and refining * No experience in DataOps neededwell train you * Bonus: experience with HubSpot or web scraping tools Youll get to work at the heart of a growing go-to-market team helping to shape how we reach and convert new customers. Youll learn how sales data really works and build a strong foundation in commercial operations. This role offers the chance to grow into RevOps SalesOps MarketingOps or more technical data roles over timedepending on your interests. This is a primarily office-based role in Belfast. Some remote work flexibility will be available over time and the role may evolve into a hybrid setup as trust and experience grow. * Competitive salary * Training and support to grow into data/revenue roles * Private health insurance * Company pension plan * 35 days annual leave * Share options * Apple laptop and WFH budget * In-person team events and company meet-ups Were reviewing applications as they come in and will be in touch quickly if it looks like a match. Stora is proud to be an equal opportunities employer. We are committed to creating a diverse and inclusive workplace where everyone is treated with dignity and respect and where individual differences are valued. We welcome applications from all suitably qualified candidates regardless of age disability gender gender reassignment marital or civil partnership status pregnancy or maternity race religious belief or political opinion or sexual orientation. All recruitment and employment decisions are made on the basis of merit competence and business need. We actively promote equality of opportunity and fair participation in line with our responsibilities under Northern Ireland equality legislation. If you require any reasonable adjustments during the recruitment process please let us know. Required Experience: IC Key Skills Data Analytics,Microsoft Access,SQL,Power BI,R,Data Visualization,Tableau,Data Management,Data Mining,SAS,Data Analysis Skills,Analytics Employment Type : Full-Time Department / Functional Area: Operations Experience: years Vacancy: 1

Immediate start following a successful interview Were hiring a Housekeeping Associates to join our amazing team here at Omni Facilities Management Established in 1980 Omni Facilities Management is a leading provider of outsourced services to over 150 hotels across the UK Netherlands and South Africa. Employing over 4000 people Omni provides Housekeeping Recruitment Property and Software Services to major hotel groups including InterContinental Hotels Group (IHG) Hilton Marriott Redefine BDL Hotels Raffles Shangri-La Ritz-Carlton and Resorts World. We are currently looking for enthusiastic and self-motivated candidates for the position ofHousekeeping Associatewho will be responsible for cleaning the hotel bedrooms bathrooms and public areas ensuring that sufficient linen is available for daily operations and might also be required to complete additional cleaning tasks in the Back of House. Benefits from working with the company: • Two weekly payments, • Up to 28 days paid holiday per year, • Permanent contract of employment, • Career progression on to our Management Programs & Flexible Learning Courses, • Company Benefits including retail discounts on food shopping clothes holidays. eating out and up to 55% on cinema tickets Up to 37.5 hours a week Monday to Sunday (24/7 Operation) Desired profile: • Experienced in the Housekeeping Department in a hotel, • Willingness to work, • Ability to work under pressure with strong organizational skills Room Attendant: • Clean hotel rooms to required standards and by required deadlines, • Complete regular cleaning routines (task of the day) as per training, • Change bed linen and towels and make beds, • High and low dusting and polishing furniture, • Clean bathrooms including vanity sink bath/shower tiles / glass and walls, • Vacuum and mop floors, • Replace stock of guest supplies such as shampoo soap and brochures e, • Re-stock drinks in the mini bar Linen Porter • Ensure the delivery of clean linen to designated areas in the hotel by specified deadlines, • Ensure the collection of soiled linen from designated areas in the hotel by specified deadlines, • Check all linen cupboards on a regular basis and ensure they are maintained in a tidy organized manner and fully stocked, • Keep the service areas clean and tidy, • Wait for the linen delivery at the times specified by the hotel, • Bring all the dirty linen to the linen room classify it and count it, • Return damaged linen and ensuring it is accounted for by following the required procedure, • Clean designated public areas of the hotel to required standards and by required deadlines, • Complete regular cleaning routines (task of the day), • Vacuum mop floors and clean windows, • Dust and polish furniture and re-stock and clean equipment used, • Replace stock of supplies such as soap toilet rolls brochures etc., • Re-stock and clean equipment used, • Attend and provide input at housekeeping meetings. Act on any special instructions and pass on relevant information, • Be responsible for all keys in your possession, • Report anything which may be considered a Health & Safety hazard. Key Skills Time Management,Customer Service,Hotel Experience,Taleo,Hospitality Experience,Industrial Cleaning,Laundry,Guest Relations Experience,Host/Hostess Experience,Cleaning Experience,Custodial Experience,Commercial Cleaning Employment Type : Full-Time Experience: years Vacancy: 1

Job Title: Office Administrator Job Type: Part-Time Salary: 21.00 per hour About Us: Top Level Promotions is a dynamic and growing organization focused on providing excellent services to our clients. We specialize in creating innovative promotional campaigns that help brands connect with their audience. We are currently seeking a highly organized and motivated Office Administrator to join our team. This is an excellent opportunity for someone looking to contribute to the efficient running of an office environment and grow within a supportive and collaborative team. Key Responsibilities: • Manage day-to-day office operations including answering phones scheduling appointments and handling correspondence., • Greet visitors and clients ensuring they are directed to the appropriate team members., • Organize and maintain office filing systems both digital and physical., • Assist in managing office supplies inventory and ordering necessary materials., • Coordinate meetings and manage office calendars., • Process and distribute incoming and outgoing mail., • Assist with basic HR tasks including maintaining employee records and scheduling interviews., • Support other departments as needed with administrative tasks., • Ensure the office is clean organized and welcoming. Qualifications: • Proven experience as an office administrator or similar role., • Strong organizational and multitasking skills with attention to detail., • Excellent written and verbal communication skills., • Proficiency in Microsoft Office Suite (Word Excel PowerPoint Outlook)., • Ability to work independently and in a team environment., • Strong interpersonal skills and a positive attitude., • High school diploma or equivalent; additional qualifications in office administration are a plus. Why Join Us • Competitive salary and benefits package., • Opportunities for professional growth and development., • Collaborative and friendly work environment. How to Apply: Please submit your resume and a cover letter detailing your experience and why you would be a great fit for this position. We are an equal-opportunity employer and welcome applications from all qualified individuals. Office Administration Key Skills Bidding,Apps,Benefits,Corporate Recruitment,Android Development Employment Type : Full Time Experience: years Vacancy: 1

Restaurant general manager Do you have the following skills, experience and drive to succeed in this role Find out below. Welcome to KFC. Home of the real ones. We sell the worlds best chicken. Weve done it for a long old time since 1939, when the idea of finger lickin good chicken popped into our Colonels head. Now, we proudly serve 1000+ communities across the UK and Ireland, bringing the grit, pride and iconic reputation that started in Kentucky all those years ago. People who are original. Individual. Fresh. We come to work to be ourselves, and to make something of ourselves. We bring the graft and the laughs every day building our own community, as we serve our original recipe chicken to the ones, were in. In our place, ambition grows. Careers build. Potential goes further. Our doors are open, and they can take you anywhere. If you join our team, we only ask one thing. That you be you. Because that makes us, us. Sounds good? Great. Heres more about the job. About the role Lead from the front, take full ownership of the restaurant, and smash performance goals while building a team that doesn't just meet standards but exceeds them. Own the numbers, the vibe, and the experience, keeping everything running smoothly while creating a space where both guests and the team thrive. What will you spend your time doing? • Lead like you mean it.Youll take full ownership of the restaurant drive performance, hit goals, and set the vibe., • Build a team worth following.Train, coach, and motivate your people so they dont just meet the standard they raise it., • Smash the targets.Own your KPIs and push the team to deliver every shift, every day., • Keep it tight.Stay on top of the admin rosters, stock, reporting so everything runs smooth behind the scenes., • You lead from the front.Youve managed teams before and know how to bring the best out of people., • You get people.You build strong teams, handle tough conversations, and create a culture where everyone feels seen. We dont hire staff we hire people. People with real lives and aspirations, building real careers. Each of us has something special to add to the mix we call work, and well always encourage you to add your perspective. See, at KFC, everyones welcome whatever your background, and whatever future youre creating. Well look out for you because youre one of us, not because you work for us. Well invest in your potential, because its what weve always done. But most of all, well give you the freedom to be you, wherever (and whoever) you happen to be. Whats in it for you: We offer benefits that make your life that little bit easier, because we know the juggle is real. • Pay rate:, • QuarterlyBONUSthat rewards the hustle, • Life assurance weve got you covered, • Free chicken & chips every shift, • 25% staff discount, • Gym discounts to keep you moving, • 200+ high street perks & cashback Our promise is this: every person who applies to a role at KFC, regardless of age, background, ethnicity, gender, ability, religion or sexual orientation, will have an equal opportunity to work here. We dont just welcome, we encourage applications from underrepresented groups in all industries. If youd like any additional support with your application, have a disability or condition that may affect your performance during the recruitment process, or have any other requirements just let us know. Well be there to help you be the real you. Ready? We hope so. If youre ready to be part of our community, nows the time to apply. Worried you arent ticking all the boxes? Dont - wed still love to hear from you. #Unitedbythebucket

Immediate start following a successful interview Were hiring a Housekeeping Associates to join our amazing team here at Omni Facilities Management Established in 1980 Omni Facilities Management is a leading provider of outsourced services to over 150 hotels across the UK Netherlands and South Africa. Employing over 4000 people Omni provides Housekeeping Recruitment Property and Software Services to major hotel groups including InterContinental Hotels Group (IHG) Hilton Marriott Redefine BDL Hotels Raffles Shangri-La Ritz-Carlton and Resorts World. We are currently looking for enthusiastic and self-motivated candidates for the position ofHousekeeping Associatewho will be responsible for cleaning the hotel bedrooms bathrooms and public areas ensuring that sufficient linen is available for daily operations and might also be required to complete additional cleaning tasks in the Back of House. Benefits from working with the company: • Two weekly payments, • Up to 28 days paid holiday per year, • Permanent contract of employment, • Career progression on to our Management Programs & Flexible Learning Courses, • Company Benefits including retail discounts on food shopping clothes holidays. eating out and up to 55% on cinema tickets Up to 37.5 hours a week Monday to Sunday (24/7 Operation) Desired profile: • Experienced in the Housekeeping Department in a hotel, • Willingness to work, • Ability to work under pressure with strong organizational skills Room Attendant: • Clean hotel rooms to required standards and by required deadlines, • Complete regular cleaning routines (task of the day) as per training, • Change bed linen and towels and make beds, • High and low dusting and polishing furniture, • Clean bathrooms including vanity sink bath/shower tiles / glass and walls, • Vacuum and mop floors, • Replace stock of guest supplies such as shampoo soap and brochures e, • Re-stock drinks in the mini bar Linen Porter • Ensure the delivery of clean linen to designated areas in the hotel by specified deadlines, • Ensure the collection of soiled linen from designated areas in the hotel by specified deadlines, • Check all linen cupboards on a regular basis and ensure they are maintained in a tidy organized manner and fully stocked, • Keep the service areas clean and tidy, • Wait for the linen delivery at the times specified by the hotel, • Bring all the dirty linen to the linen room classify it and count it, • Return damaged linen and ensuring it is accounted for by following the required procedure, • Clean designated public areas of the hotel to required standards and by required deadlines, • Complete regular cleaning routines (task of the day), • Vacuum mop floors and clean windows, • Dust and polish furniture and re-stock and clean equipment used, • Replace stock of supplies such as soap toilet rolls brochures etc., • Re-stock and clean equipment used, • Attend and provide input at housekeeping meetings. Act on any special instructions and pass on relevant information, • Be responsible for all keys in your possession, • Report anything which may be considered a Health & Safety hazard. Key Skills Time Management,Customer Service,Hotel Experience,Taleo,Hospitality Experience,Industrial Cleaning,Laundry,Guest Relations Experience,Host/Hostess Experience,Cleaning Experience,Custodial Experience,Commercial Cleaning Employment Type : Full-Time Experience: years Vacancy: 1

Teammember Welcome to KFC. Home of the real ones. Wesell the worlds best chicken. Weve done it for a long old time since 1939when the idea of finger lickin good chicken popped into our Colonels head. Now we proudlyserve 1000 communities across the UK and Ireland bringing the grit pride andiconic reputation that started in Kentucky all those years ago. People who areoriginal. Individual. Fresh. We come to work to be ourselves and to makesomething of ourselves. We bring the graft and the laughs every day buildingour own community as we serve our original recipe chicken to the ones werein. In our place ambition grows. Careers goes further. Our doors are open and they can take you anywhere. If you join our team we only ask one you be you. Because that makes us us. Sounds good Great. Heres more about the job. About the role Youll be the heartbeat of therestaurant serving up great food good vibes and real moments. No matterwhere youre working front middle or back you bring the energy and wellbring the rest. Whatwill you spend your time doing • Serve up good vibes greet every guestlike theyre family., • Own the front take orders handlethe tills and keep things clean and slick., • Stay cool underpressure rush hour No problem., • Prep like a pro slice dice and getthe goods ready fast., • Keep it spotless hygienes notoptional its the standard. What wed love from you: • Keep calm and crack on pressures part ofthe game., • Care about quality of the food theservice and the team., • Spread good vibes your attitude makesthe shift. Keeping it real We dont hire staff we hire people. Peoplewith real lives and aspirations building real careers. Each of us hassomething special to add to the mix we call work and well always encourageyou to add your perspective. See at KFC everyones welcome whateveryour background and whatever future youre creating. Well look out for youbecause youre one of us not because you work for us. Well invest in yourpotential because its what weve always done. But most of all well give youthe freedom to be you wherever (and whoever) you happen to be. Whatsin it for you: We offerbenefits that make your life that little bit easier because we know the juggleis real. • Pay rate:, • Takethe first steptoward a rewarding leadership career., • Free food and drink on shift, • 25% staff discount KFCfor everyone: Whoeveryou are and wherever youre from KFC is a place where you can bring the real you to work. Were here to support you in being yourself whether you work withus or are trying to. Our promise is this: every person who applies to a role at KFC regardless of age background ethnicity gender abilityreligion or sexual orientation will have an equal opportunity to work here. We dont just welcome we encourage applications fromunderrepresented groups in all industries. If youd like any additional support with your application have a disability or condition that may affect yourperformance during the recruitment process or have any other requirements just let us know. Well be there to help you be the real you. Ready We hope so. Ifyoure ready to be part of our community nows the time to apply. Worried you arent ticking all theboxes Dont - wed still love to hear from you. Key Skills Dhcp,Ethernet,Information Technology Sales,Customer Development,ITI Employment Type : Full-Time Experience: years Vacancy: 1

Restaurant general manager Do you have the following skills, experience and drive to succeed in this role Find out below. Welcome to KFC. Home of the real ones. We sell the worlds best chicken. Weve done it for a long old time since 1939, when the idea of finger lickin good chicken popped into our Colonels head. Now, we proudly serve 1000+ communities across the UK and Ireland, bringing the grit, pride and iconic reputation that started in Kentucky all those years ago. People who are original. Individual. Fresh. We come to work to be ourselves, and to make something of ourselves. We bring the graft and the laughs every day building our own community, as we serve our original recipe chicken to the ones, were in. In our place, ambition grows. Careers build. Potential goes further. Our doors are open, and they can take you anywhere. If you join our team, we only ask one thing. That you be you. Because that makes us, us. Sounds good? Great. Heres more about the job. About the role Lead from the front, take full ownership of the restaurant, and smash performance goals while building a team that doesn't just meet standards but exceeds them. Own the numbers, the vibe, and the experience, keeping everything running smoothly while creating a space where both guests and the team thrive. What will you spend your time doing? • Lead like you mean it.Youll take full ownership of the restaurant drive performance, hit goals, and set the vibe., • Build a team worth following.Train, coach, and motivate your people so they dont just meet the standard they raise it., • Smash the targets.Own your KPIs and push the team to deliver every shift, every day., • Keep it tight.Stay on top of the admin rosters, stock, reporting so everything runs smooth behind the scenes., • You lead from the front.Youve managed teams before and know how to bring the best out of people., • You get people.You build strong teams, handle tough conversations, and create a culture where everyone feels seen. We dont hire staff we hire people. People with real lives and aspirations, building real careers. Each of us has something special to add to the mix we call work, and well always encourage you to add your perspective. See, at KFC, everyones welcome whatever your background, and whatever future youre creating. Well look out for you because youre one of us, not because you work for us. Well invest in your potential, because its what weve always done. But most of all, well give you the freedom to be you, wherever (and whoever) you happen to be. Whats in it for you: We offer benefits that make your life that little bit easier, because we know the juggle is real. • Pay rate:, • QuarterlyBONUSthat rewards the hustle, • Life assurance weve got you covered, • Free chicken & chips every shift, • 25% staff discount, • Gym discounts to keep you moving, • 200+ high street perks & cashback Our promise is this: every person who applies to a role at KFC, regardless of age, background, ethnicity, gender, ability, religion or sexual orientation, will have an equal opportunity to work here. We dont just welcome, we encourage applications from underrepresented groups in all industries. If youd like any additional support with your application, have a disability or condition that may affect your performance during the recruitment process, or have any other requirements just let us know. Well be there to help you be the real you. Ready? We hope so. If youre ready to be part of our community, nows the time to apply. Worried you arent ticking all the boxes? Dont - wed still love to hear from you. #Unitedbythebucket

Restaurant general manager Do you have the following skills, experience and drive to succeed in this role Find out below. Welcome to KFC. Home of the real ones. We sell the worlds best chicken. Weve done it for a long old time since 1939, when the idea of finger lickin good chicken popped into our Colonels head. Now, we proudly serve 1000+ communities across the UK and Ireland, bringing the grit, pride and iconic reputation that started in Kentucky all those years ago. People who are original. Individual. Fresh. We come to work to be ourselves, and to make something of ourselves. We bring the graft and the laughs every day building our own community, as we serve our original recipe chicken to the ones, were in. In our place, ambition grows. Careers build. Potential goes further. Our doors are open, and they can take you anywhere. If you join our team, we only ask one thing. That you be you. Because that makes us, us. Sounds good? Great. Heres more about the job. About the role Lead from the front, take full ownership of the restaurant, and smash performance goals while building a team that doesn't just meet standards but exceeds them. Own the numbers, the vibe, and the experience, keeping everything running smoothly while creating a space where both guests and the team thrive. What will you spend your time doing? • Lead like you mean it.Youll take full ownership of the restaurant drive performance, hit goals, and set the vibe., • Build a team worth following.Train, coach, and motivate your people so they dont just meet the standard they raise it., • Smash the targets.Own your KPIs and push the team to deliver every shift, every day., • Keep it tight.Stay on top of the admin rosters, stock, reporting so everything runs smooth behind the scenes., • You lead from the front.Youve managed teams before and know how to bring the best out of people., • You get people.You build strong teams, handle tough conversations, and create a culture where everyone feels seen. We dont hire staff we hire people. People with real lives and aspirations, building real careers. Each of us has something special to add to the mix we call work, and well always encourage you to add your perspective. See, at KFC, everyones welcome whatever your background, and whatever future youre creating. Well look out for you because youre one of us, not because you work for us. Well invest in your potential, because its what weve always done. But most of all, well give you the freedom to be you, wherever (and whoever) you happen to be. Whats in it for you: We offer benefits that make your life that little bit easier, because we know the juggle is real. • Pay rate:, • QuarterlyBONUSthat rewards the hustle, • Life assurance weve got you covered, • Free chicken & chips every shift, • 25% staff discount, • Gym discounts to keep you moving, • 200+ high street perks & cashback Our promise is this: every person who applies to a role at KFC, regardless of age, background, ethnicity, gender, ability, religion or sexual orientation, will have an equal opportunity to work here. We dont just welcome, we encourage applications from underrepresented groups in all industries. If youd like any additional support with your application, have a disability or condition that may affect your performance during the recruitment process, or have any other requirements just let us know. Well be there to help you be the real you. Ready? We hope so. If youre ready to be part of our community, nows the time to apply. Worried you arent ticking all the boxes? Dont - wed still love to hear from you. #Unitedbythebucket

Restaurant general manager Do you have the following skills, experience and drive to succeed in this role Find out below. Welcome to KFC. Home of the real ones. We sell the worlds best chicken. Weve done it for a long old time since 1939, when the idea of finger lickin good chicken popped into our Colonels head. Now, we proudly serve 1000+ communities across the UK and Ireland, bringing the grit, pride and iconic reputation that started in Kentucky all those years ago. People who are original. Individual. Fresh. We come to work to be ourselves, and to make something of ourselves. We bring the graft and the laughs every day building our own community, as we serve our original recipe chicken to the ones, were in. In our place, ambition grows. Careers build. Potential goes further. Our doors are open, and they can take you anywhere. If you join our team, we only ask one thing. That you be you. Because that makes us, us. Sounds good? Great. Heres more about the job. About the role Lead from the front, take full ownership of the restaurant, and smash performance goals while building a team that doesn't just meet standards but exceeds them. Own the numbers, the vibe, and the experience, keeping everything running smoothly while creating a space where both guests and the team thrive. What will you spend your time doing? • Lead like you mean it.Youll take full ownership of the restaurant drive performance, hit goals, and set the vibe., • Build a team worth following.Train, coach, and motivate your people so they dont just meet the standard they raise it., • Smash the targets.Own your KPIs and push the team to deliver every shift, every day., • Keep it tight.Stay on top of the admin rosters, stock, reporting so everything runs smooth behind the scenes., • You lead from the front.Youve managed teams before and know how to bring the best out of people., • You get people.You build strong teams, handle tough conversations, and create a culture where everyone feels seen. We dont hire staff we hire people. People with real lives and aspirations, building real careers. Each of us has something special to add to the mix we call work, and well always encourage you to add your perspective. See, at KFC, everyones welcome whatever your background, and whatever future youre creating. Well look out for you because youre one of us, not because you work for us. Well invest in your potential, because its what weve always done. But most of all, well give you the freedom to be you, wherever (and whoever) you happen to be. Whats in it for you: We offer benefits that make your life that little bit easier, because we know the juggle is real. • Pay rate:, • QuarterlyBONUSthat rewards the hustle, • Life assurance weve got you covered, • Free chicken & chips every shift, • 25% staff discount, • Gym discounts to keep you moving, • 200+ high street perks & cashback Our promise is this: every person who applies to a role at KFC, regardless of age, background, ethnicity, gender, ability, religion or sexual orientation, will have an equal opportunity to work here. We dont just welcome, we encourage applications from underrepresented groups in all industries. If youd like any additional support with your application, have a disability or condition that may affect your performance during the recruitment process, or have any other requirements just let us know. Well be there to help you be the real you. Ready? We hope so. If youre ready to be part of our community, nows the time to apply. Worried you arent ticking all the boxes? Dont - wed still love to hear from you. #Unitedbythebucket

Personally presentable, chefs are required to serve the food, you must be clean and presentable at all times. We are currently hiring a brunch chef to join our kitchen team.

Social network you want to login/join with:.Ruby Engineer / Outside IR35/ Onsite in Belfast / 6 Month Contract.I'm on the lookout for a Ruby engineer to join a fast-paced full-stack product team, you will be on the back-end team working on writing clean, tested, maintainable and efficient Ruby code.

Part Time Recruitment Officer (14925b), Belfast. Kingdom Healthcare have an excellent opportunity for a Part Time Recruitment Officer to join our established and successful team. They must be able to operate independently and as part of a larger team: a clean driving licence is essential for this ro

Monitor cleaning supplies, ensuring the team has what they need to uphold your squeaky-clean standards. Previous leadership experience is an asset, but a strong cleaning background and enthusiasm for progression is key. A proactive attitude, willing to adapt to changing cleaning priorities and suppo

A Pret Team Member or Team Member Star works as part of a team in a Pret shop in the kitchen, front of house and delivery. To take the time to respond to customers’ needs delivering outstanding and amazing service. To wear a clean and immaculate uniform at all times whilst on shift.

Are you eager for a new role? As a Bar Team Member, you'll ensure customers receive exceptional service and perfectly served drinks every time. You'll keep the bar area clean and help ensure fridges are stocked.

Duty Manager - Ramada Belfast JOIN US At RBH we believe our people are our biggest assets and understand the value in putting them first. Our approach to diversity in the workplace, health & wellbeing, sustainability and individuality sets us apart from our competitors and is one of the reasons we are rated Top 30 Best Places to Work in Hospitality! We are passionate about the industry and always on the lookout for new talent to join us on our journey... OUR HOTEL OUR BENEFITS You will have access to a benefits package we believe truly works for our people • Discounted hotel room rates for you and your friends & family, • An additional day's leave for your birthday, • Enhanced Maternity, adoption & shared parental leave, • Course Sponsorship, • 30% F&B discount at RBH hotels, • Refer a Friend scheme (earn 250 for each referral up to 5 referrals), • Flexible working arrangements, • Wagestream - choose how and when you get paid, • Life Insurance, • Employee Assistance Programme, • Social and wellness events and activities all year round, • Free meals on duty saving you over 1000 per year A DAY IN THE LIFE OF A DUTY MANAGER AT OUR HOTEL What you'll be doing... • Lead the team with a positive vibe, helping create a welcoming and seamless service experience., • Oversee daily shift activities, from setting up tables to making sure orders flow smoothly and guests are happy., • Support and guide the team, helping with training and encouraging everyone to deliver their best., • Step in with confidence to handle guest requests and resolve issues, keeping the service upbeat and responsive., • Coordinate with the kitchen and bar to keep things moving like clockwork, from orders to plating., • Monitor stock levels and assist with inventory, ensuring we're set up for success every shift., • Help with scheduling and shift planning, making sure the team is prepared and ready to go., • Keep the dining and service areas sparkling clean and compliant, with an eye on health and safety., • Working across all front of house areas of the hotel, assisting and leading the team WHAT WE NEED FROM YOU • A natural people person who's excited to take on a leadership role, with some experience in food and beverage., • Strong communication skills, able to motivate and energise team members while keeping things running smoothly., • Quick thinking and problem-solving skills to handle guest needs on the fly., • Organised and adaptable, managing multiple tasks with ease., • A team player through and through, ready to jump in wherever needed to support the crew. RBH Hospitality Management is an equal opportunity employer. We believe in hiring a diverse workforce and sustaining an inclusive, people-first culture. If at any point throughout our process you require reasonable adjustments, please contact .

You will work enthusiastically as a member of a team that promotes and supports Adults with Support Needs to actively take part within local resources and facilities, to maximise their inclusion, independence and planned outcomes. You should have an understanding of the rights and responsibilities o

Technical Team Leader (Residential Conveyancing), 5+ Years PQE, Remote Working, £Competitive (DOE) - This is a fantastic opportunity for a confident legal professional who thrives on solving complex issues and supporting a high-performing team.

To work within the Councils estate of buildings undertaking cleaning duties as directed by line manager in accordance with the practices and procedures of the service.

The post holder will be the conduit between Service Manager and the front line clinical teams. The post holder liaises closely with members of the multi-disciplinary team to improve channels of communication, allow maximum utilisation of resources, and promote continuity and co-ordination of the ser

As a Receptionist at a Barchester care home, you'll provide the warm welcome that helps to make sure every resident and visitor feels at home with us.As the first point of contact for almost everyone who comes to the home, you'll have a vitally important part to play in creating a positive and frien

As the UK’s best-known retailer of tech, we’re proud of the service our customers receive – and it’s all down to our team of 25,000 caring and committed colleagues. You’ll work in a great team, learning and growing together, and celebrating the big and small moments that make every day ama

As a Care Assistant at a Barchester complex care home, you'll help residents enjoy each day by making sure they get the quality care they deserve.We'll look to you to support our residents with a variety of needs, including advanced or young onset dementia, multiple sclerosis, neuro rehab and Huntin

The post holder liaises closely with members of the multi-disciplinary team to improve channels of communication, allow maximum utilisation of resources, and promote continuity and co-ordination of the services within their sphere of responsibility. To champion and support the PICU sisters, charge n

Blue Arrow are recruiting for postal/van drivers for our client based in Dalry.Location: Dalry Delivery Office.Shift: working 5/7 rota (site provide rota).PAYE (holiday pay accrued on top of hourly rate).You can also be out on foot delivering mail door to door.If you are interested please call the o

The post holder will be the conduit between Service Manager and the front line clinical teams. The post holder liaises closely with members of the multi-disciplinary team to improve channels of communication, allow maximum utilisation of resources, and promote continuity and co-ordination of the ser

You will work enthusiastically as a member of a team that promotes and supports Adults with Support Needs to actively take part within local resources and facilities, to maximise their inclusion, independence and planned outcomes. You should have an understanding of the rights and responsibilities o

The post holder will be the conduit between Service Manager and the front line clinical teams. The post holder liaises closely with members of the multi-disciplinary team to improve channels of communication, allow maximum utilisation of resources, and promote continuity and co-ordination of the ser

As a Bank Care Assistant at a Barchester care home, you'll help residents enjoy each day by making sure they get the quality care and support they deserve.You'll assist with daily living, providing support and companionship and sharing great moments and memories too.It's a chance to bring your dedi

What you’ll do Friendly and thoughtful service – you’ll give friendly, welcoming, easy, helpful and thoughtful service every day, often taking ownership for managing the store and handling challenging situations Develop your

You’ll need to be resilient too and willing to learn new skills and develop your knowledge as part of a close-knit team. Career path opportunities to develop your career into management / team leader once you have gained a good level of experience.

The post holder will be the conduit between Service Manager and the front line clinical teams. The post holder liaises closely with members of the multi-disciplinary team to improve channels of communication, allow maximum utilisation of resources, and promote continuity and co-ordination of the ser

To champion and support the PICU sisters, charge nurses and team leaders to implement corporate wide initiatives. The post holder will be the conduit between Service Manager and the front line clinical teams. The post holder liaises closely with members of the multi-disciplinary team to improve chan

As the UK’s best-known retailer of tech, we’re proud of the service our customers receive – and it’s all down to our team of 25,000 caring and committed colleagues. You’ll work in a great team, learning and growing together, and celebrating the big and small moments that make every day ama

What you’ll do - Friendly and thoughtful service – you’ll give friendly, welcoming, easy, helpful and thoughtful service every day, often taking ownership for managing the store and handling challenging situations - Develop your team's capabilities through coaching and training, fostering an

Pension scheme What You’ll Do: Lead with Compassion: Deliver person-centred care to residents living with dementia, treating each individual with kindness, empathy, and respect Set the Standard: Ensure care practices are safe, effective, and in line with current dementia care best practices Inspir

Job Description We have a fantastic opportunity for you to join our Challenge-trg Recruitment team as a full time Tesco Warehouse Operative in Antrim, BT414NN.

The post holder liaises closely with members of the multi-disciplinary team to improve channels of communication, allow maximum utilisation of resources, and promote continuity and co-ordination of the services within their sphere of responsibility. To champion and support the PICU sisters, charge n

Job Description Role overview: 7.T Delivery & Install Driver Ballyclare, BT39 Belfast Belfast Customer Service Centre Permanent Full Time Salary: £29,421 OTE of £33000 with quarterly bonus and potential overtime Shift Pattern: 5 over 7 (Tuesday - Saturday) At Currys were united by one passi

Make extra money in a way that suits you - anytime, any day.Take charge of your earnings by becoming a self-employed delivery rider with Just Eat.Flexible hours - choose your own schedule and work when it suits you.Weekly pay - get paid, every week.No experience needed - just bring your motivation.T

Job Description Fancy a work-life balance that puts you in the drivers seat? At The Sofa Delivery Company, delivering moments that matter is what were all about.With our 4-on, 4-off shift pattern, 7am - 7pm, youll have plenty of time to relax, recharge, and enjoy life outside of work.As a Driver, y

Make extra money in a way that suits you - anytime, any day.Take charge of your earnings by becoming a self-employed delivery rider with Just Eat.Flexible hours - choose your own schedule and work when it suits you.Weekly pay - get paid, every week.No experience needed - just bring your motivation.T

The post holder will be the conduit between Service Manager and the front line clinical teams. The post holder liaises closely with members of the multi-disciplinary team to improve channels of communication, allow maximum utilisation of resources, and promote continuity and co-ordination of the ser

Make extra money in a way that suits you - anytime, any day.Take charge of your earnings by becoming a self-employed delivery rider with Just Eat.Flexible hours - choose your own schedule and work when it suits you.Weekly pay - get paid, every week.No experience needed - just bring your motivation.T

Job Description Role overview: 7.T Delivery & Install Driver Ballyclare, BT39 Belfast Belfast Customer Service Centre Permanent Full Time Salary: £29,421 OTE of £33000 with quarterly bonus and potential overtime Shift Pattern: 5 over 7 (Tuesday - Saturday) At Currys were united by one passi

Make extra money in a way that suits you - anytime, any day.Take charge of your earnings by becoming a self-employed delivery rider with Just Eat.Flexible hours - choose your own schedule and work when it suits you.Weekly pay - get paid, every week.No experience needed - just bring your motivation.T

As one of our Self-Employed Core Delivery Drivers you'll enjoy freedom, flexibility and better financial rewards, plus all the support and benefits of being part of our wider Yodel team. You'll get all the independence of being self-employed, plus the backing of our expert team and access to a Yodel

Make extra money in a way that suits you - anytime, any day.Take charge of your earnings by becoming a self-employed delivery rider with Just Eat.Flexible hours - choose your own schedule and work when it suits you.Weekly pay - get paid, every week.No experience needed - just bring your motivation.T

Make extra money in a way that suits you - anytime, any day.Take charge of your earnings by becoming a self-employed delivery rider with Just Eat.Flexible hours - choose your own schedule and work when it suits you.Weekly pay - get paid, every week.No experience needed - just bring your motivation.T

Make extra money in a way that suits you - anytime, any day.Take charge of your earnings by becoming a self-employed delivery rider with Just Eat.Flexible hours - choose your own schedule and work when it suits you.Weekly pay - get paid, every week.No experience needed - just bring your motivation.T

Make extra money in a way that suits you - anytime, any day.Take charge of your earnings by becoming a self-employed delivery rider with Just Eat.Flexible hours - choose your own schedule and work when it suits you.Weekly pay - get paid, every week.No experience needed - just bring your motivation.T

Make extra money in a way that suits you - anytime, any day.Take charge of your earnings by becoming a self-employed delivery rider with Just Eat.Flexible hours - choose your own schedule and work when it suits you.Weekly pay - get paid, every week.No experience needed - just bring your motivation.T

Make extra money in a way that suits you - anytime, any day.Take charge of your earnings by becoming a self-employed delivery rider with Just Eat.Flexible hours - choose your own schedule and work when it suits you.Weekly pay - get paid, every week.No experience needed - just bring your motivation.T

Make extra money in a way that suits you - anytime, any day.Take charge of your earnings by becoming a self-employed delivery rider with Just Eat.Flexible hours - choose your own schedule and work when it suits you.Weekly pay - get paid, every week.No experience needed - just bring your motivation.T

Make extra money in a way that suits you - anytime, any day.Take charge of your earnings by becoming a self-employed delivery rider with Just Eat.Flexible hours - choose your own schedule and work when it suits you.Weekly pay - get paid, every week.No experience needed - just bring your motivation.T

Make extra money in a way that suits you - anytime, any day.Take charge of your earnings by becoming a self-employed delivery rider with Just Eat.Flexible hours - choose your own schedule and work when it suits you.Weekly pay - get paid, every week.No experience needed - just bring your motivation.T

Make extra money in a way that suits you - anytime, any day.Take charge of your earnings by becoming a self-employed delivery rider with Just Eat.Flexible hours - choose your own schedule and work when it suits you.Weekly pay - get paid, every week.No experience needed - just bring your motivation.T