Business office jobs in NailseaCreate job alerts

Hello, Thank you for your interested in our L2-L3 Systems Engineer position here at Teleperformance UK. We’re looking for a self-driven and proactive Systems Engineer (Level 2–3) with a genuine passion for technology and problem-solving. This role is ideal for someone who thrives in dynamic environments, takes ownership of their work, and brings solid experience primarily with Microsoft infrastructure and cloud solutions. You’ll be part of a team that values initiative, continuous learning, and delivering robust technical solutions that support our evolving business needs. Please note, that we are eager to get to know you even if you don’t fully “tick all the boxes” on the desired skill list below. We value a can-do attitude and desire to learn and actively participate within the team Hours: Full-time 37.5 hours per week, Monday to Friday, office hours, although some weekend and out-of-hour work may be required to assist business needs. The successful candidate may be expected to join an on-call rota. Contract Term: Permanent The Role Participate in the maintenance, monitoring, implementation and decommission of IT systems, including servers, storage and hardware; and provide professional support and knowledge of Teleperformance systems to internal business units and clients. They will submit recommendations for system improvements, including security, to IT management team and help maintain the optimal operational environment of the Teleperformance IT Systems. Objectives of the role Support and improve operational IT systems, implement new and decommission old solutions • Provide 2nd - 3rd Line support for IT systems, infrastructure and Cloud technologies, • Help design new solutions, based on operational requirements, • knowledge of the following IT components/Solutions: Windows Server 2016+, AD Domain Services, DHCP, DNS, Azure, GPO, VMWare, Hyper-V (desires), Exchange, M365, Email Filtering & Web Filtering (desired), MECM/TANIUM (desired), Veeam Backup, overall AV Solutions (Trend, Falcon CS), Monitoring & DEX platforms such as SolarWinds, ControlUp, Splunk, Strong Hardware proficiency (Ex: Synergy, Nimble, Brocade, Service BAU requests., • Securing systems to Cyber Essentials, PCI DSS and ISO27000 standards through audits, vulnerability scanning and remediation, • Documentation, creation, update and keeping to date., • Assist in the migration from, consolidation of and/or decommission of legacy systems The Ideal Candidate Personal competencies • At least 3-5 years IT Systems Team / 3rd Line Infrastructure Support experience, • Strong troubleshooting, analytical and support skills, • Organised, efficient and able to prioritise tasks / plan own time, • Strong communication skills both verbal and written, • Be able to think ‘out of the box’, providing creative ideas and solutions, • Team player and driven by success, aiming for quality service, • Experience in a Call Centre environment or similar would be advantageous Required skills • SC clearance / SC clearance capable is a big advantage., • Windows Server 2016+, configuration, administration and support, • Hardware support, including racking / (un)racking, • Microsoft Azure Services, • Conditional access knowledge is desirable, • Other cloud platforms are desirable, • Windows Domain Services – AD Services, DHCP, DNS, Sites & Services, • Experience with VMware and some Hyper-V, • Other Hypervisors are desirable, • Experience with MECM is desirable, • Experience with Tanium is desirable, • Experience with Anti-Malware solutions, e.g. Falcon CS, • System Monitoring and centralized logging, e.g. SolarWinds, Splunk, ControlUp, Chronicle, • Windows Terminal Server / RDS desirable, • Linux administration desirable, • Knowledge and experience of Role Based Access, • MS Azure Associate/Expert desirable Teleperformance is a worldwide leader in multichannel customer experience management. We are experts in the call centre services industry and add value to our client’s service by delivering great customer service and solutions on their behalf. We’ve been providing superior customer care for leading brands throughout the world since 1978 and every year we interact with more than 35% of the world’s population.

Internal Sales / Sales Coordinator – Building & Construction Sector Location : Avonmouth, Bristol Hours : 42.5 per week. Sales Office is open 0700-1700, so there needs to be coverage during those hours. There is a rota in place, with some staggered start and end time Reference : 1M26011 Package : To£30,500 (with a salary review after probation) + excellent benefits The Thrive Hive are thrilled to be working with one of our longest-standing clients to help them find an exceptional Internal Sales / Sales Coordinator to join their friendly, fast-paced sales team in Avonmouth, Bristol. If you love being the go-to person who keeps everything running smoothly — and you get a buzz from supporting customers and colleagues alike — this could be your perfect next move. Why you’ll love this role You’ll become the heartbeat of the sales office, acting as the first point of contact for B2B and B2C customers, supporting field sales reps, and keeping operations slick and seamless behind the scenes. Think of it as the perfect blend of customer care, organisation wizardry and commercial know-how. What you’ll be doing day-to-day • Handling incoming calls and emails from new and existing customers — offering friendly, knowledgeable support., • Building strong relationships across the business and with external partners., • Resolving queries quickly and professionally, ensuring great customer experiences every time., • Sourcing and pricing materials and preparing competitive quotations using the CRM system., • Processing orders accurately and efficiently., • Supporting field-based sales representatives whenever needed., • Preparing and posting product samples and helping with general office duties to keep the department running smoothly. What we’re looking for • Previous experience in a sales role — ideally within the building or construction industry (although this bit is not essential), • Confident communicator (written and verbal) with a naturally proactive, positive approach., • Strong IT skills including Outlook, Word and Excel., • A highly organised multitasker with excellent attention to detail., • A team player who’s also capable of managing their own workload independently., • Knowledge of aggregates or construction materials would be a bonus, but not essential. Why join? Our client genuinely invests in their people — offering ongoing learning, development and progression opportunities. It’s a team where support, growth and positive culture aren’t just buzzwords; they’re part of everyday life.

Shipping & Export Administrator (Ongoing Contract) Clevedon (On-site) £16.50 per hour Agency: BMR Solutions BMR Solutions are working in partnership with a leading advanced manufacturing business in Clevedon to recruit a Shipping & Export Administrator on an ongoing contract basis. This is a fast-paced, hands-on role where you’ll play a key part in ensuring the smooth and compliant shipment of systems, upgrades and spare parts worldwide. You’ll act as a central coordination point across the factory, supporting logistics, calibration, and stock visibility. The Role • Ensure all systems, upgrades, and spares are shipped daily in line with business requirements, • Liaise with shipping partners to secure capacity and meet deadlines, • Coordinate and support the calibration process across the site, • Continuously review and improve processes in collaboration with internal teams, • Track systems held in offsite storage and support customer communication, • Identify and escalate shipping cost issues, driving resolution, • Support general logistics and administrative activities as required What We’re Looking For • Previous administration experience (logistics/export environment desirable), • Strong working knowledge of Microsoft Office, • Excellent verbal and written communication skills, • Highly organised with the ability to manage multiple priorities Important Requirement: Due to aviation security regulations, you must be able to provide a full 5-year work history and references to meet Known Consignor requirements. What’s on Offer • £16.50 per hour, • Ongoing contract with long-term potential, • Opportunity to work within a collaborative and high-performing team, • Exposure to a global manufacturing and logistics environment Location This role is fully on-site in Clevedon, offering a collaborative team environment and close interaction with logistics, production, and engineering teams. Diversity & Inclusion BMR Solutions and our client are committed to creating an inclusive workplace where everyone can thrive. We welcome applications from all backgrounds and experiences and believe diversity strengthens our teams. If you’re an organised administrator with strong coordination skills and experience in a fast-paced environment, apply today.

Internal Sales / Sales Coordinator – Building & Construction Sector Location : Avonmouth, Bristol Hours : 42.5 per week. Sales Office is open 0700-1700, so there needs to be coverage during those hours. There is a rota in place, with some staggered start and end time Reference : 1M26011 Package : To£30,500 (with a salary review after probation) + excellent benefits The Thrive Hive are thrilled to be working with one of our longest-standing clients to help them find an exceptional Internal Sales / Sales Coordinator to join their friendly, fast-paced sales team in Avonmouth, Bristol. If you love being the go-to person who keeps everything running smoothly — and you get a buzz from supporting customers and colleagues alike — this could be your perfect next move. Why you’ll love this role You’ll become the heartbeat of the sales office, acting as the first point of contact for B2B and B2C customers, supporting field sales reps, and keeping operations slick and seamless behind the scenes. Think of it as the perfect blend of customer care, organisation wizardry and commercial know-how. What you’ll be doing day-to-day • Handling incoming calls and emails from new and existing customers — offering friendly, knowledgeable support., • Building strong relationships across the business and with external partners., • Resolving queries quickly and professionally, ensuring great customer experiences every time., • Sourcing and pricing materials and preparing competitive quotations using the CRM system., • Processing orders accurately and efficiently., • Supporting field-based sales representatives whenever needed., • Preparing and posting product samples and helping with general office duties to keep the department running smoothly. What we’re looking for • Previous experience in a sales role — ideally within the building or construction industry (although this bit is not essential), • Confident communicator (written and verbal) with a naturally proactive, positive approach., • Strong IT skills including Outlook, Word and Excel., • A highly organised multitasker with excellent attention to detail., • A team player who’s also capable of managing their own workload independently., • Knowledge of aggregates or construction materials would be a bonus, but not essential. Why join? Our client genuinely invests in their people — offering ongoing learning, development and progression opportunities. It’s a team where support, growth and positive culture aren’t just buzzwords; they’re part of everyday life.

Interim Group Financial Controller - North Somerset (Hybrid) Morgan McKinley are working exclusively with a client based in North Somerset to recruit an experienced Interim Group Financial Controller for an initial 3-6 month assignment. This is a hands-on leadership role managing a small finance team, with responsibility for group reporting, month-end processes, cashflow, controls, forecasting and supporting the business through ongoing change and restructuring activity. The successful candidate will be a qualified accountant with previous experience within construction, manufacturing or retail environments, ideally in businesses that have undergone significant transformation. If you also have any experience in mergers and acquisitions this would be a huge benefit. You will be confident operating at pace, able to drive improvements and available at short notice. The role is hybrid, requiring a minimum of 3 days per week in the office, with occasional travel to other sites. If interested, please call Lucy at Morgan McKinley on (phone number removed) or click apply

Proven experience as an Operational Buyer or similar procurement-oriented role. A leading high-technology engineering and manufacturing business is currently recruiting for an Operational Buyer on a full-time, permanent basis, with hybrid working between home and their Bristol office. Role - Operational Buyer Type - Permanent Location - Clevedon (Hybrid) Salary - Up to £40,000 Key responsibilities for the Operational Buyer will include and will not be limited to: Raise purchase orders through multiple channels/methods. Act on MRP messages to expedite, defer or cancel open order lines. Issue RFQs, release drawings, analyse supplier quotes, and set up replenishment profiles for new parts. Resolve delivery accuracy issues, quality rejects, invoice queries, overdue orders, and production shortages. Identify savings opportunities through benchmarking, value engineering and optimising replenishment methods. Work with Engineering on obsolete/replacement parts, including concessions (temporary permits) and engineering changes.Key skills and experience required for Operational Buyer job applicant and will not be limited to: 2-3+ years' experience in Procurement / Buying. Strong negotiation skills with a proven track record against savings and delivery targets. Confident working in a complex environment, able to prioritise and react quickly to supply issues. Professional communicator with strong internal stakeholder and supplier management skills. Resourceful, self-motivated and comfortable working on your own initiative. CIPS Level 4 (or equivalent) or equivalent through experience. Experience supporting New Product Introduction (NPI), outsourcing and continuous improvement projects (desirable).To apply for this Operational Buyer / Buyer / Purchasing Buyer / Procurement Buyer / Materials Buyer candidates must be eligible to live and work in the UK

Part Time HSEQ Manager Nailsea Part Time and Hybrid Yolk Recruitment is partnered with a growing environmental engineering business in the recruitment of an HSEQ Manager. This position has become available as part of the company's current growth and expansion plans. The company provides you with the opportunity to work across a diverse range of UK and European engineering projects in a collaborative and safety-focused environment. You'll lead HSEQ strategy, drive compliance with legislation and ISO standards, support audits and risk management and work closely with senior leadership to continuously improve company safety and quality systems across site operations. This is what you will be doing: Lead and coordinate HSEQ strategy in collaboration with senior management. Drive a proactive HSEQ culture ensuring compliance with legislation and ISO standards. Develop, implement, and maintain the company safety management system. Provide expert HSEQ advice, guidance, and support across all operations and projects. Lead incident reporting, investigation, and root cause analysis with corrective actions. Produce, review, and maintain risk assessments, method statements, and H&S documentation. Deliver and manage HSEQ training, competency frameworks, and onboarding processes. Conduct internal audits and support continuous improvement of HSEQ systems and performance. This is the experience you will bring to the role: Experience as a Health & Safety leader in environmental, engineering, manufacturing or industrial sectors. Communicate effectively and influence senior leadership and teams leaders. Experience implementing ISO9001 and ISO14001 management systems. Experience with quality auditing and environmental permitting regulations. Relevant qualifications: degree or equivalent experience , H&S Diploma/Certificate, NEBOSH or IOSH certification. This is what you will get in return: Part time hours (24 hrs per week). Hybrid office and home working (2 days office and 1 home) Company pension Life insurance Private medical insurance Christmas and New Year Site wide shut down Are you up to the challenge? If you feel you have the skills, experience and passion to be successful in this role apply now. *Please note, whilst we do our best to contact all candidates, due to the high number of applications we receive we cannot guarantee this for every role. If you have not heard anything from us within 7 days of applying - then unfortunately you have been unsuccessful. Please keep an eye on our website for more opportunities

Customer Services Office Administrator Location: Clevedon, Somerset Are you an organised and customer-focused administrator looking for your next opportunity? Our client, a well-established engineering company based in Clevedon, is looking to recruit a Customer Services Office Administrator to support the delivery of customer orders and ensure excellent customer service across the business. As Customer Services Office Administrator, you will: Support the delivery of customer orders to agreed requirements Work closely with the Customer Service Manager and other departments across the business Provide excellent customer service and administrative support Help ensure smooth day-to-day office operations Promote and support the company's core values and employee ownership culture Key Skills and Experience required for this role: Previous experience in a customer service or office administration role Strong communication and organisational skills Good attention to detail Ability to work well within a team environment This is a fantastic opportunity to join a successful engineering business with a supportive team environment and strong company values. To apply, please send your CV to Or call (phone number removed) for more information

Fire & Security Engineer ( Service / Remedials) Location: North Somerset (all work within 45 mins- 1 hour of base) Salary: £38,000-£42,000 basic + OT 1.5x + on-call payments ( 1 in 8 , £185) Hours: Mon-Fri, 08:00-17:00 Contract: Permanent, Full-time Ideally candidate will live no more than 30- 45 mins from main office The Role We're looking for a multi-disciplined Fire & Security Engineer (Grade 3) to join a growing business in North Somerset, Bristol. This is mainly service and remedial work role , with a strong focus on planned preventive maintenance (PPM)-no long-distance travel and no overnight stays. What you'll be doing Carrying out service, remedial and PPM visits across fire and security systems Working on systems including intruder alarms, fire alarms, access control and CCTV (IP & analogue) Ensuring works meet relevant British Standards and NSI requirements Accurately completing job paperwork / updates via CRM/PDA Taking part in an on-call rota (1 in 8) What we're looking for Time served engineer and/or IPAF ECS (or CSCS) card FIA qualified (preferred not essential) Ideally multi-disciplined across Fire & Security Good IT/admin ability (MS Office / job systems) and strong customer service Full UK driving licence Pay, on-call & benefits Basic: £38k-£42k On-call: 1 in 8, with max average 1 call-out per week On-call payment: £185 per week when on-call Paid door-to-door (travel time paid) Overtime: time and a half after hours Company van provided 25 days holiday (plus bank holidays, if applicable) Power tools provided

Continuous Improvement Engineer Location: Bristol (On-Site) Salary: Up to £60,000 + Excellent Benefits + up to 7.5% bonus Company: BMR Solutions Ltd (Recruitment Partner) We’re hiring BMR Solutions Ltd are partnering with a leading engineering and manufacturing business in Bristol to recruit a Continuous Improvement Engineer. If you’re passionate about Lean, Six Sigma, and driving real operational change, this is a role where you can make a visible impact. What you’ll be doing: • Deliver Lean Six Sigma training across the business, • Coach and mentor teams to embed continuous improvement culture, • Lead cross-functional improvement projects (waste reduction, efficiency, quality), • Define and maintain Lean manufacturing standards, • Facilitate root cause analysis and structured problem-solving, • Track and report on KPIs (productivity, cost, quality), • Represent continuous improvement initiatives at group level What we’re looking for: • Engineering degree (or equivalent), • Lean Six Sigma Green Belt, • Experience within manufacturing or engineering environments, • Strong communication and stakeholder engagement skills, • Ability to work independently and drive initiatives, • Solid IT skills (MS Office), • Experience with risk mitigation and project delivery We encourage applications from candidates who may not meet every requirement but bring relevant experience and the right mindset. What’s on offer: • Salary up to £60,000, • On-site role with strong team collaboration, • Career development and continuous learning opportunities, • Supportive, forward-thinking culture, • Comprehensive benefits package About BMR Solutions Ltd BMR Solutions Ltd is a trusted recruitment partner to engineering and manufacturing businesses across the UK, connecting skilled professionals with high-quality opportunities. Diversity, Equity & Inclusion BMR Solutions Ltd and our client are committed to building inclusive workplaces where everyone feels valued, respected, and supported. We welcome applications from all backgrounds and ensure a fair and accessible recruitment process for all. Interested? Apply now or contact BMR Solutions Ltd to find out more

Shipping & Export Administrator (Ongoing Contract) Clevedon (On-site) £16.50 per hour Agency: BMR Solutions BMR Solutions are working in partnership with a leading advanced manufacturing business in Clevedon to recruit a Shipping & Export Administrator on an ongoing contract basis. This is a fast-paced, hands-on role where you’ll play a key part in ensuring the smooth and compliant shipment of systems, upgrades and spare parts worldwide. You’ll act as a central coordination point across the factory, supporting logistics, calibration, and stock visibility. The Role • Ensure all systems, upgrades, and spares are shipped daily in line with business requirements, • Liaise with shipping partners to secure capacity and meet deadlines, • Coordinate and support the calibration process across the site, • Continuously review and improve processes in collaboration with internal teams, • Track systems held in offsite storage and support customer communication, • Identify and escalate shipping cost issues, driving resolution, • Support general logistics and administrative activities as required What We’re Looking For • Previous administration experience (logistics/export environment desirable), • Strong working knowledge of Microsoft Office, • Excellent verbal and written communication skills, • Highly organised with the ability to manage multiple priorities Important Requirement: Due to aviation security regulations, you must be able to provide a full 5-year work history and references to meet Known Consignor requirements. What’s on Offer • £16.50 per hour, • Ongoing contract with long-term potential, • Opportunity to work within a collaborative and high-performing team, • Exposure to a global manufacturing and logistics environment Location This role is fully on-site in Clevedon, offering a collaborative team environment and close interaction with logistics, production, and engineering teams. Diversity & Inclusion BMR Solutions and our client are committed to creating an inclusive workplace where everyone can thrive. We welcome applications from all backgrounds and experiences and believe diversity strengthens our teams. If you’re an organised administrator with strong coordination skills and experience in a fast-paced environment, apply today

CBRE Global Workplace Solutions is a leading global provider of integrated facilities and corporate real estate management. We are recruiting an Electrical engineer for our site in Nailsea. About the Role: As a CBRE Electrical Technician, you will inspect, repair, replace, install, wire, adjust, and maintain all equipment for an assigned location. This job is part of the Engineering and Technical Services job function. They are responsible for providing support, preventive maintenance, and repairs on equipment and systems. What You'll Do: Review and follow instructions covering the scheduled and emergency repair, installation, and inspection of work to be done. Advise when the immediate shutdown of equipment is necessary to minimize damage, or when temporarily continued operations will have no harmful effect. Dismantle, clean, repair, replace, etc. electrical equipment taking all safety precautions. Make mechanical repairs as required in connection with the servicing of electrical equipment. Install, splice, or replace sections of wire incidental to repair or temporary installation. Make emergency mechanical repairs without other maintenance personnel. Use existing procedures to solve straightforward problems while having a limited opportunity to exercise discretion. Impact through clearly defined duties, methods, and tasks are described in detail. Deliver own output by following defined procedures and processes under close supervision and guidance.What You'll Need: High School Diploma, GED, or trade school diploma with 1-2 years of job-related experience. In lieu of a diploma, a combination of experience and education will be considered. Meet the physical requirements of this role including stooping, standing, walking, climbing stairs/ladders, and the ability to lift/carry heavy loads of 50 lbs. or more. Ability to follow basic work routines and standards in the application of work. Communication skills to exchange straightforward information. Working knowledge of Microsoft Office products. Examples include Word, Excel, Outlook, etc. Strong organizational skills with an inquisitive mindset. Basic math skills. Ability to calculate simple figures such as percentages, discounts, and markups. Why CBRE When you join CBRE, you become part of the global leader in commercial real estate services and investment that helps businesses and people thrive. We are dynamic problem solvers and forward-thinking professionals who create significant impact. Our collaborative culture is built on our shared values - respect, integrity, service and excellence - and we value the diverse perspectives, backgrounds and skillsets of our people. At CBRE, you can chart your own course and realize your potential. We welcome all applicants. Applicant AI Use Disclosure We value human interaction to understand each candidate's unique experience, skills and aspirations. We do not use artificial intelligence (AI) tools to make hiring decisions, and we ask that candidates disclose any use of AI in the application and interview process. Our Values RESPECT: We act with consideration for others' ideas and share information openly to inspire trust and encourage collaboration INTEGRITY: No one individual, no one deal, no one client, is bigger than our commitment to our company and what we stand for SERVICE: We approach our clients challenges with enthusiasm and diligence, building long-term relationships by connecting the right people, capital and opportunities EXCELLENCE: We focus relentlessly on creating winning outcomes for our clients, employees and shareholdersAbout CBRE Global Workplace Solutions: As one of CBRE's core global businesses, Global Workplace Solutions (GWS) provides end-to-end services to occupier clients across the entire lifecycle of a building. Our teams help companies improve their operations and reduce costs, through expert facilities management, project management, real estate and energy and sustainability services. Our dedicated teams work across all industries, and support clients ranging from global Fortune 500 companies to single, iconic buildings. CBRE Group, Inc. is the world's largest commercial real estate services and investment firm, with 2019 revenues of $23.9 billion and more than 100,000 employees (excluding affiliate offices). CBRE has been included on the Fortune 500 since 2008, ranking #128 in 2020. It also has been voted the industry's top brand by the Lipsey Company for 19 consecutive years and has been named one of Fortune's "Most Admired Companies" for eight years in a row, including being ranked number one in the real estate sector in 2020, for the second consecutive year. Its shares trade on the New York Stock Exchange under the symbol "CBRE." Application Process: Your application will be reviewed by our Talent Resourcing Team, and you will be contacted if you have been successful in being short listed for the role. Taking into consideration the costs of sponsorship, the nature of the role and the financial resources of the account in question, we are unable to offer sponsorship for this role. No agencies please. Please note: the job title shown above may be different to local job titles used in our business and issued on any contract of employment. #GWSEMEA

Despatch Administrator Location: Clevedon, North Somerset Hours: 40 hours per week 08:45 to 16:45 Monday to Thursday 08:45 to 16:00 Friday with early finish Salary: Competitive, available on application Contract: Permanent We are recruiting for a Despatch Administrator to join a growing food manufacturing business at their Clevedon site. This role sits within the Supply Chain team and reports to the Inside Sales Team Leader. Key Responsibilities of a Despatch Administrator: • Deliver a high level of customer service, liaising with customers and suppliers, • Process sales and purchase orders efficiently, • Manage customer expectations and ensure deliveries are on time and in full, • Respond promptly to customer queries and orders, • Coordinate despatch of goods with logistics providers and hauliers, • Prepare despatch documentation, • Manage and coordinate third party storage Key Skills of a Customer Service & Despatch Administrator: • Previous experience in customer service and/or despatch, • Strong attention to detail and ability to work in a fast-paced environment, • Confident communicator and effective team player, • Competent in Microsoft Office including Word, Excel and Outlook, • GCSE Maths and English (or equivalent) at Grade B or above, • Excellent time management and flexible approach, • Full Right to Work in the UK, • Full clean driving licence Benefits: • Auto-enrolment pension scheme (3% employer, 5% employee), • WPA Healthcare NHS Top-up Scheme after probation, • Death in Service benefit, • Employee Benefits Scheme and Employee Assistance Programme, • Generous holiday entitlement increasing with service

HR Shared Services Advisor | Supply Chain We are working with a growing, people-focused business looking to bring in a HR Shared Services Advisor to join their team. This is a great opportunity for someone who enjoys being at the heart of HR operations, supporting a fast-paced environment and delivering a really positive employee experience across a supply chain setting. You'll be part of a busy and collaborative team, acting as a key point of contact for managers and employees across operational and head office functions. What you'll be doing: • Acting as the first point of contact for HR queries across the business Supporting with employee relations queries and guiding managers through day-to-day issues Managing HR administration across the full employee lifecycle Supporting onboarding and offboarding processes Maintaining HR systems and ensuring data is accurate and up to date * Working closely with the wider HR team to support key projects and initiatives What we're looking for • Previous experience in a HR Shared Services or HR Advisor role Experience within a supply chain, logistics or operational environment would be highly beneficial Comfortable managing a range of HR queries in a fast-paced setting Strong attention to detail and organisational skills Confident communicator who enjoys building relationships across different areas of the business This is a great role for someone looking to continue developing within a supportive HR team, with exposure to a really dynamic operational environment. Salary up to c£35,000 DOE Please apply with your most up to date CV. BH35755

Air Freight Coordinator £28000 to £30,000 per annum, Permanent, 09:00am to 17:30pm M-F, BS35 Severn Beach, Bristol, 31 days Holiday, Bonus, Pension, Health plan, Eye care, On site Parking and employee shares plan. Expanding, forward thinking and team orientated, A multi-billion pound global freight forwarding business who are actively recruiting for a air freight coordinator to join their team. With 350 office's worldwide, this will see you working in their brand new, purpose built offices playing a vital part within their team : Tracking and maintaining smooth running of freight process. Accurate data entry of freight information. Client and vendor invoicing. Client contact updating on delivery and rapport building. General department administration. The successful air freight coordinator will have a need to hold an administrative background, be proficient within the use of Microsoft programs and be confident in picking up new packages. It would be beneficial to hold current CRM system experience but full training will be provided within their bespoke system. This would be an excellent opportunity for someone holding logistics administration, export administration, freight administration or transport administration type experience. This opportunity working as an air freight coordinator will see you working within an office of 50 employees, within a personable team of 5 and with the full support of experienced air freight individuals and a direct line manager who is career served within freight forwarding. Offering future chance of progression, this is the chance to join a career focused business which will give you training, stability and a fantastic team culture. Benefits include : 23 days holidays plus bank holidays Bonus Health plan Eye care Employee share purchase plan On-site Parking Working within a brand new, modern office space Apply today for your immediate consideration or apply direct to For further information, please call Richard Hughes on (phone number removed) or (phone number removed). Travail Employment Group Ltd is acting as an Employment Agency in relation to this vacancy. Thanks for your application. Due to the high level of responses we are currently receiving, whilst we endeavour to contact everyone, sometimes we are unable to. If you have not heard from us within 10 working days of making your application, please assume that you have been unsuccessful on this occasion

Road Freight Coordinator £26,000 to £28,000 per annum, Permanent, 09:00am to 17:30pm M-F, BS35 Severn Beach, Bristol, 31 days Holiday, Pension, Health plan, Eye care, On site Parking and employee shares plan. Expanding, forward thinking and team orientated, A multi-billion pound global freight forwarding business who are actively recruiting for a road freight agent to join their team. With 350 office's worldwide, this will see you working in their brand new, purpose built offices playing a vital part within their team : Tracking and maintaining smooth running of freight process. Accurate data entry of freight information. Client and vendor invoicing. Client contact updating on delivery and rapport building. General department administration. The successful road freight coordinator will have a need to hold an administrative background, be proficient within the use of Microsoft programs and be confident in picking up new packages. It would be beneficial to hold current CRM system experience but full training will be provided within their bespoke system. This would be an excellent opportunity for someone holding logistics administration, export administration, freight administration or transport administration type experience. This opportunity working within road freight coordinator will see you working within an office of 50 employees, within a personable team of 5 and with the full support of experienced road freight individuals and a direct line manager who is career served within road freight forwarding. Offering future chance of progression, this is the chance to join a career focused business which will give you training, stability and a fantastic team culture. Benefits include : 31 days holidays Including bank holidays Bonus Health plan Eye care Employee share purchase plan On-site Parking Working within a brand new, modern office space 26 days work from home per year Apply today for your immediate consideration or apply direct to For further information, please call Richard Hughes on (phone number removed) or (phone number removed). Travail Employment Group Ltd is acting as an Employment Agency in relation to this vacancy. Thanks for your application. Due to the high level of responses we are currently receiving, whilst we endeavour to contact everyone, sometimes we are unable to. If you have not heard from us within 10 working days of making your application, please assume that you have been unsuccessful on this occasion

Freight Coordinator £26,000 to £30,000 per annum, Permanent, 09:00am to 17:30pm M-F, BS35 Severn Beach, Bristol, Bonus, 31 days Holiday, Pension, Health plan, Eye care, On site Parking and employee shares plan. A highly established, leading freight forwarding business who are expanding their ocean freight team in recruiting for a freight coordinator to join their team. Providing customer excellence and holding fantastic company values which include sustainability, joining this team orientated, employee focused business will not disappoint you. Working within an ocean freight department as a freight coordinator part of 4 with the full support of a team leader and supervisor, this opportunity will see you : ·Tracking and maintaining smooth running of freight process ·Accurate data entry of freight information ·Client and vendor invoicing ·Client contact updating on delivery and rapport building ·General department administration The successful freight coordinator will have a need to hold an administrative or customer services background, be proficient within the use of Microsoft programs and be confident in picking up new packages. It would be beneficial to hold current CRM system experience but full training will be provided within their bespoke system. Previous freight industry experience would be beneficial but not essential. This freight coordinator opportunity would be an excellent role for someone holding air freight, import / export coordinator, freight coordinator or freight forwarder experience. All freight, Transport and customs experience will be considered. Customer services experience will also be consider where you will be given full training and investment. This opportunity working within freight coordination will see you working within an office of 80 employees with the full support of experienced freight individuals and direct line managers who is career served within freight forwarding. Offering future chance of progression, this is the chance to join a career focused business which will give you training, stability and a fantastic team culture. Benefits include : Full training from day one and further on-going training and development opportunities Year end bonus Company shares scheme Health insurance Pension Work from home 2 days per month 31 days holiday including bank holidays Company events Apply today for your immediate consideration or apply direct to (url removed) For further information, please call Richard Hughes on (phone number removed) or (phone number removed) Travail Employment Group Ltd is acting as an Employment Agency in relation to this vacancy. Thanks for your application. Due to the high level of responses we are currently receiving, whilst we endeavour to contact everyone, sometimes we are unable to. If you have not heard from us within 10 working days of making your application, please assume that you have been unsuccessful on this occasion

Freight Coordinator £28,000 to £30,000 per annum, Permanent, 09:00am to 17:30pm M-F, BS35 Severn Beach, Bristol, Bonus, 31 days Holiday, Pension, Health plan, Eye care, On site Parking and employee shares plan. A highly established, leading freight forwarding business who are expanding their air freight team in recruiting for a freight coordinator to join their team. Providing customer excellence and holding fantastic company values which include sustainability, joining this team orientated, employee focused business will not disappoint you. Working within an air freight department as a freight coordinator part of 4 with the full support of a team leader and supervisor, this opportunity will see you : ·Tracking and maintaining smooth running of freight process ·Accurate data entry of freight information ·Client and vendor invoicing ·Client contact updating on delivery and rapport building ·General department administration The successful freight coordinator will have a need to hold an administrative or customer services background, be proficient within the use of Microsoft programs and be confident in picking up new packages. It would be beneficial to hold current CRM system experience but full training will be provided within their bespoke system. Previous freight industry experience would be beneficial but not essential. This freight coordinator opportunity would be an excellent role for someone holding air freight, import / export coordinator, freight coordinator or freight forwarder experience. All freight, Transport and customs experience will be considered. Customer services experience will also be consider where you will be given full training and investment. This opportunity working within freight coordination will see you working within an office of 80 employees with the full support of experienced freight individuals and direct line managers who is career served within freight forwarding. Offering future chance of progression, this is the chance to join a career focused business which will give you training, stability and a fantastic team culture. Benefits include : Full training from day one and further on-going training and development opportunities Year end bonus Company shares scheme Health insurance Pension Work from home 2 days per month 31 days holiday including bank holidays Company events Apply today for your immediate consideration or apply direct to (url removed) For further information, please call Richard Hughes on (phone number removed) or (phone number removed) Travail Employment Group Ltd is acting as an Employment Agency in relation to this vacancy. Thanks for your application. Due to the high level of responses we are currently receiving, whilst we endeavour to contact everyone, sometimes we are unable to. If you have not heard from us within 10 working days of making your application, please assume that you have been unsuccessful on this occasion

Our Civils contractor client are seeking a Quality Manager to support projects across Wales and the South West, ideally commutable to Bristol Avonmouth offices. The Quality Manager is responsible for reviewing, developing, and maintaining the company's Quality Management System (QMS) in line with current industry standards. The role ensures consistent quality performance, regulatory compliance, and continuous improvement across all operations. The role will require site, office and home working, supporting the like of Wessex Water, Welsh Water and National Grid projects. The role report to the company SHEQ Director. Key Responsibilities Review and benchmark the existing Quality Management System against industry standards Develop and implement an updated QMS aligned with best practices Ensure effective rollout and ongoing management of the QMS across the business Lead and conduct internal quality audits Support external audits, including preparation and close-out activities Ensure compliance with relevant standards, including ISO 9001 and sustainability regulations Define, update, and maintain quality procedures in collaboration with stakeholders Lead continuous improvement initiatives across the organisation Monitor quality performance through data analysis and reporting Identify improvement opportunities and implement corrective action plans Manage Non-Conformance Reports (NCRs) Conduct root cause analysis and implement corrective actions through to resolution Establish and maintain document control procedures Review and update policies, recommending improvements and implementation plans Work with procurement to communicate quality standards to the supply chain Liaise with managers and staff to promote quality standards Provide training, tools, and techniques to support quality compliance Ensure the company operates efficiently and maintains a competitive edge Drive consistent adherence to quality standards across all functions Qualifications & Experience Minimum of 5 years' experience in Quality Management Proven experience in developing and communicating Quality Management Systems ISO 9001:2015 Internal Auditor qualification (preferred) Benefits Salary up to £70,000 per annum Car allowance Hybrid working (site, office, and home-based) Further benefits package discussed on application

Job Title: Hire Desk Manager Location: Avonmouth, Bristol (Office Based) Salary: Depending on Experience Job Type: Permanent, Full Time Working Hours: Hours of work will be 8.00am to 5.30pm, Monday to Friday. King Lifting provides crane hire services to the construction industry along with plant and machinery movement solutions, operating from depots across the UK. We are a modern family-run business with a strong reputation and a proven track record within the industry. We are currently seeking an experienced Hire Desk Manager to take responsibility for the day-to-day operation and smooth running of our Bristol hire desk. This is an office-based role so you must live within a commutable distance to Avonmouth, Bristol. Key Responsibilities: Allocation of assets and labour on a daily basis. Handling inbound telephone enquiries ensuring all requests are actioned efficiently. Liaising with operatives to ensure all relevant information is provided prior to works commencing. Raising contracts, job sheets and operator tickets. Ensuring all operative training/medical requirements are up to date and compliant with Company policies. Procuring plant, labour and equipment from external suppliers when required. Liaising with customers to ensure site-specific requirements are met prior to site attendance. Ensuring all cranes and yard equipment inspections are current and compliant with LOLER regulations. Managing annual leave requests for operatives and hire desk staff. About you: This is a fast-paced and demanding role. We are looking for a confident and organised individual who thrives under pressure, demonstrates excellent attention to detail and possesses strong interpersonal and communication skills. A positive and proactive approach is essential. As well as this, you will: Be proficient in Microsoft Office Have previous experience working on a hire desk and/or within the crane or plant hire industry Have experience managing sub-contractors across multiple geographical locations In return you will receive: Competitive salary dependent on your skills and experience Quarterly bonus (dependent upon the results of your depot) Generous holiday allowance Company pension Life assurance Employee Assistance Programme Flexible Benefits Platform with generous monthly Company contribution Reward and recognition incentives Retail discount hubs Ongoing training and development opportunities Additional Information: Please click apply to be redirected to our careers page to complete your application. If you want to stand out from the rest, we would encourage you to include a covering letter stating why you would be the ideal candidate for King Lifting. You must have the right to live and work in the UK otherwise, your application will automatically be rejected. King Lifting is an Equal Opportunities employer. NO AGENCIES PLEASE Candidates with the experience or relevant job titles of; Plant Hire Manager, Fleet Management, Logistics Operations, Planning Administrator, Logistics Planner, Scheduling Manager, Logistics Manager, Crane Hire Coordinator, Plant Hire Operations Manager, Plant Controller, Vehicle Controller may also be considered

Graduate/Trainee Recruitment Consultant - Competitive basic salary plus uncapped commission - Portishead Following a sustained period of growth, Hunter Selection are seeking bright, driven and ambitious candidates to join our team based in Portishead. As a Graduate/Trainee Recruitment Consultant at Hunter Selection, you will: Work in a team environment alongside like-minded, supportive and experienced colleagues who will give you all of the tools to succeed. Have full responsibility for building and managing your own client base, working with your team to service these customers to the highest possible standards. Bring in new clients and vacancies through business development activity. Manage your client base, spotting opportunities to grow and develop these and maximise these relationships. Search for and interview candidates suitable for your teams' target markets and existing clients. Arrange external interviews for candidates and manage the recruitment process from start to finish. Advertise and search for suitable candidates using job boards, social media and personal networksBenefits of working for Hunter Selection include: Uncapped earning potential Full and extensive training program Regular salary reviews and performance based pay rises Genuine team-based working, which is a rarity in the recruitment industry! Working for a purpose-driven, BCorp company where our employees and their welfare are at the core of everything we do Employee share ownership scheme, where you can become a shareholder within the business Private healthcare scheme Regular team and individual incentives A fun, supportive and respectful environment in which to learn, develop and become the best!If you are an ambitious person who wants a career in a busy, team-based environment with unlimited earning opportunities then please get in touch. A proven training program will be provided to all successful candidates. The role is office based, and you would be working out of our amazing headquarters in Portishead with a team of bright, ambitious and career-minded people who are driven by success and achieving common goals. Please click apply as soon as you can - we're keen to speak to you! Key words: Recruitment, Sales, Account Management, Interviewing, Advertising, Marketing, BA, BSc, BEng, Graduate If you are interested in this position please click 'apply'. Hunter Selection Limited is a recruitment consultancy with offices UK wide, specialising in permanent & contract roles within Engineering & Manufacturing, IT & Digital, Science & Technology and Service & Sales sectors. Please note as we receive a high level of applications we can only respond to applicants whose skills & qualifications are suitable for this position. No terminology in this advert is intended to discriminate against any of the protected characteristics that fall under the Equality Act 2010. For the purposes of the Conduct Regulations 2003, when advertising permanent vacancies we are acting as an Employment Agency, and when advertising temporary/contract vacancies we are acting as an Employment Business

Unqualified Teaching Assistant Location: Portishead and surrounding areas Salary: £93 – £100 per day (depending on experience and qualifications) Start Date: September 2026 Applicants must provide proof of right to work in the UK. About the Opportunity Connex Education are recruiting enthusiastic and motivated Trainee Teaching Assistants to support a range of welcoming primary schools across Portishead and nearby areas. We have flexible opportunities available including day-to-day supply, short-term cover, and long-term placements beginning in September 2026. We are proud to be working in partnership with a highly regarded Multi-Academy Trust across the Southwest. The Trust is known for its supportive leadership teams, inclusive approach to education, and commitment to staff development and pupil wellbeing. This position is ideal for anyone looking to gain valuable classroom experience and begin a rewarding career within education. As a Trainee Teaching Assistant, you will work closely with teachers and pupils across EYFS, KS1 and KS2, helping to create engaging and positive learning experiences. Your responsibilities may include: Supporting pupils within the classroom environment Working with children on a one-to-one basis and in small groups Assisting teachers with lesson preparation and classroom activities Encouraging pupil participation and confidence Helping to maintain a safe, inclusive and engaging learning environment Why Work with Connex Education? Competitive daily rates of pay Weekly PAYE payments Free access to our Teaching Assistant Toolkit with over 24 CPD courses Funded qualifications including Level 2 SEND, Level 3 Teaching & Learning, Level 4 HLTA and Level 5 TEFL Ongoing training and wellbeing support Dedicated guidance from experienced education consultants Person Specification We are looking for candidates who: Have a genuine passion for supporting children and young people Are interested in pursuing a career in education Possess strong communication and interpersonal skills Are adaptable, positive and reliable Can build strong professional relationships with pupils and staff Have experience working with children (preferred but not essential) Have knowledge of Phonics or Read Write Inc. (desirable) Hold a DBS on the update service or are willing to apply for one Interested? If you would like to begin your career in education or find out more about available opportunities in Portishead and the surrounding areas, apply today. For further information, contact the Bristol office on (phone number removed) or email Connex Education Partnership is committed to equal opportunities and values diversity. We do not discriminate based on age, gender, sexual orientation, race, ethnic origin, religion, culture, marital status, or disability. All candidates are assessed on merit alone. Connex Education Partnership is an employment agency and employment business. Connex Education Partnership is committed to safeguarding and promoting the welfare of children and young people and expects all staff and candidates to share this commitment. We adhere to Safer Recruitment practices in line with Keeping Children Safe in Education (KCSIE), Working Together to Safeguard Children 2023, and other relevant legislation. All appointments are subject to rigorous pre-employment checks, including references and an enhanced DBS check

Customer Services Administrator £26,000 per annum, Permanent, 09:00am to 17:30pm M-F, BS35 Severn Beach, Bristol, 33 days Holiday, Pension, Health plan, Eye care, On site Parking and employee shares plan. Expanding, forward thinking and team orientated, A multi-billion pound global freight forwarding business who are actively recruiting for a customers services administrator to join their team. With 350 office's worldwide, this will see you working in their modern, purpose built offices playing a vital part within their team : Handling client / customer calls processing orders. Inputting order information and checking inventory records. Producing Inventory reports via internal system. Raising client invoices. Liaise with transport companies to arrange UK based pick up / delivery of products. Provide Warehouse staff with order information to prepare for dispatch. Email and telephone correspondence with clients. The successful customer services administrator will have a need : To Hold an administrative background Be proficient within the use of Microsoft programs and be confident in picking up new packages. CRM system experience would be beneficial but full training This Customer service administrator opportunity would be an excellent role for someone holding warehouse administration, stock administration, sales administration or transport administration type experience. This opportunity working as customer services administrator will see you working within an office of 60 employees, within a personable team of 7 and with the full support of experienced administrators and a direct line manager. Offering future chance of progression, this is the chance to join a career focused business which will give you training, stability and a fantastic team culture. Benefits include : 31 days holidays Including bank holidays Bonus Health plan Eye care Employee share purchase plan On-site parking Working within a brand new, modern office space Career progression and training opportunities Full training provided Staff events Apply today for your immediate consideration or apply direct to For further information, please call Richard Hughes on (phone number removed) or (phone number removed). Travail Employment Group Ltd is acting as an Employment Agency in relation to this vacancy. Thanks for your application. Due to the high level of responses we are currently receiving, whilst we endeavour to contact everyone, sometimes we are unable to. If you have not heard from us within 10 working days of making your application, please assume that you have been unsuccessful on this occasion

Customer Services Office Administrator Reporting To The Customer Services Office Administrator will report directly to the Customer Service Manager and will work closely with all departments across the business to support the successful delivery of customer orders and outstanding customer service. Role Overview The Customer Services Office Administrator is responsible for coordinating customer orders from receipt through to delivery, ensuring all customer requirements are met accurately, efficiently, and within agreed timescales. The role involves supporting sales order processing, customer communication, delivery coordination, and administrative activities to help drive operational efficiency and customer satisfaction. The successful candidate will play a key role in supporting the continued success of the business while promoting the Employee Ownership culture and Core Values. As part of PB the Employee Ownership model, all employees are encouraged to take ownership of their work, contribute positively to the team, and support continuous improvement across the business. Employee Ownership Expectations As a partner, you will share in both the responsibilities and rewards of ownership. Employees are expected to: • Take responsibility for delivering an excellent customer experience and contributing to business success, • Work collaboratively as part of a team, embracing the Core Values, • Support continuous improvement and personal development opportunities, • Help create a positive and supportive working environment, • Promote and actively support Employee Ownership across the business Key ResponsibilitiesSales Administration • Create and process Sales Orders accurately in line with customer purchase order requirements, • Ensure customer details and order information are correctly entered into company systems, • Complete satisfactory credit checks where required, • Create part records for new products, including associated Bills of Materials (BOMs), • Generate Works Orders for manufactured components and products, • Acknowledge customer orders promptly and professionally, • Respond to customer enquiries and requests in a timely manner, • Maintain accurate sales and customer records Delivery Coordination • Liaise with internal departments and customers to coordinate the delivery of customer orders, • Arrange transportation and logistics in line with customer requirements, • Identify and manage any special delivery or shipping requirements, • Generate dispatch notes and associated shipping documentation, • Ensure consignments comply with Health & Safety, environmental, and legal requirements, including ADR, Dangerous Goods Notes (DGN), export documentation, and related compliance procedures, • Provide customers with manuals, drawings, test certificates, and other relevant documentation following dispatch, • Keep customers informed of delivery schedules, delays, and updates, • Respond promptly to customer delivery queries Purchasing & Office Support Provide basic purchasing and administrative support during periods of absence or increased workload, including: • Raising purchase orders, • Supporting day-to-day purchasing activities, • Carrying out general office administration duties, • Assisting with filing, record keeping, and document control General Responsibilities • Maintain records of customer requirement changes and updates, • Adhere to company quality procedures and standards at all times, • Comply with all Health & Safety, environmental, and legal requirements, • Maintain a safe, clean, and organised working environment, • Undertake additional reasonable duties as requested by management Key Performance Indicators (KPIs) Percentage of customer orders dispatched on time Accuracy of order processing and documentation Customer response and resolution times Customer satisfaction and service levels Relevant Quality Standards QAP2.1 QAP2.2 QAP2.8 QAP4.1 Qualifications & Knowledge GCSEs (or equivalent) in English and Maths Previous experience within a customer service, sales administration, or office administration role Good geographical knowledge and understanding of delivery logistics Understanding of sales order processing and customer service principles Knowledge of export, shipping, or compliance documentation would be advantageous Skills & Experience Strong administrative and organisational skills Excellent verbal and written communication skills High level of attention to detail and accuracy Ability to prioritise workload and manage multiple tasks effectively Good IT skills, including Microsoft Office packages Ability to work collaboratively across departments Proactive and customer-focused approach Personal Attributes & Behaviours Professional and customer-focused attitude Excellent communicator with strong interpersonal skills Highly organised with strong attention to detail Flexible, reliable, and adaptable Positive team player with a collaborative approach Ability to use initiative and solve problems effectively Committed to continuous improvement and personal development

Customer Services Administrator Clevedon | Hybrid | Full-Time | Permanent Salary up to £28,000 + FANTASTIC company benefits! Monday–Thursday: 8:00am–5:00pm | Early finish Friday: 8:00am–12:15pm! A well-established and growing manufacturing business based in Clevedon is looking to appoint a proactive and detail-focused Customer Services Administrator to join its collaborative customer services team. This is an excellent opportunity for someone with previous customer service or sales administration experience who enjoys working in a fast-paced environment, building strong customer relationships and coordinating orders from start to finish. Working Pattern & Benefits • Hybrid working: 3 days office-based / 2 days from home, • Typical working hours (flexible start and finish times, based on a 38.5-hour week): Monday–Thursday: 8:00am–5:00pm, Friday: 8:00am–12:15pm, • Career development opportunities, • Enhanced 12% pension (5% employee, 7% employer), • Partner Profit Share, Death in Service insurance, Employee referral scheme, • Free onsite parking, • Cycle to Work Scheme, Tech Scheme, • Company events, regular wellbeing activities, Mental Health First Aiders on site, • Charity involvement with Children’s Hospice South West, • Cashback health plan; includes private GP access, Employee Assistance Programme, and shopping discounts Responsibilities will include: • Managing customer orders and processing documentation, • Capacity planning and coordinating production requirements, • Creating Manufacturing Packs for internal teams, • Arranging despatch and tracking deliveries, • Providing excellent customer communication and support, • Liaising with internal departments to ensure smooth order fulfilment, • Maintaining accurate records and systems What We’re Looking For • Strong communication skills and excellent attention to detail, • A proactive and organised approach, • Ability to manage multiple priorities, • Confident working with customers and internal stakeholders, • Good IT and administrative skills For further information please contact Justyna on (phone number removed). This advert represents a summary of the full role description. To apply, please submit a copy of your up to date CV clearly indicating your relevant experience. Applicants must have an existing right to work in the UK and evidence of eligibility will be required. Suitable candidates will be contacted

Job Title: Planning Co-ordinator Location: Clevedon, North Somerset Hours: 40 hours per week 08:45 to 16:45 Monday to Thursday 08:45 to 16:00 Friday Salary: Competitive, depending on experience Overview of a Planning Coordinator: This position would suit a highly motivated energetic person, who is task focused with great attention to detail and an excellent communicator. We are looking for a confident team player who can work on their own initiative as well as covering the day to day requirements of a fast-paced environment, who has previous production planning experience. Key Responsibilities of a Planning Coordinator: • Manage production planning activities in an accurate and timely manner in line with customer requirements, • Control and manage works orders to meet customer expectations, • Identify opportunities for business improvement and implement best practice, • Communicate effectively across departments to ensure smooth operations, • Support day-to-day planning activities within a fast-paced manufacturing environment Key Skills of a Planning Coordinator: • Previous experience in production planning within a manufacturing environment, • Strong attention to detail and organisational skills, • Ability to work well under pressure and manage multiple priorities, • Confident communicator with a proactive and positive approach, • Competent in Microsoft Office, including Word, Excel and Outlook, • Good level of Maths and English (GCSE or equivalent), • Full UK right to work and full clean driving licence Benefits: • Auto-enrolment pension scheme (3% employer, 5% employee), • Healthcare scheme after probation, • Death in service benefit (2x salary), • Employee benefits scheme and assistance programme, • 25 days holiday plus bank holidays, increasing with service

Proven experience as a Buyer or similar procurement-oriented role. A leading high-technology engineering and manufacturing business is currently recruiting for a Strategic Sourcing Buyer on a full-time, permanent basis, with hybrid working between home and their Bristol office. Role - Strategic Sourcing Buyer Type - Permanent Location - Clevedon (Hybrid) Salary - Up to £48,000 Key responsibilities for the Strategic Sourcing Buyer will include and will not be limited to: Create and deliver category plans for your commodities, in line with business goals. Build and manage a strong supplier list for both day-to-day needs and long-term plans, reducing and improving the supply base where needed. Put long-term supplier agreements and service levels in place, including buffer stock agreements (BSA) and letters of warranty (LoW). Improve supply chain resilience by using a wider supplier network and reducing risk. Create and maintain continuity plans for critical suppliers and parts. Make sure suppliers can meet demand by planning ahead, checking capacity, and securing commitments. Lead cost-saving projects across the supply base without compromising quality or delivery. Work closely with manufacturing to improve material flow and efficiency. Partner with Engineering, Production, Customer Service and Quality, bringing suppliers in early for new products and technology projects. Ensure suppliers meet compliance standards (regulatory, ethical, environmental and governance) and support smooth supplier onboarding.Key skills and experience required for Strategic Sourcing Buyer job applicant and will not be limited to: Minimum bachelor's degree in Engineering, Business Administration, Supply Chain or similar. CIPS qualification Level 4. Minimum 10 years' procurement experience, ideally within a manufacturing or engineering environment. At least 5 years in a strategic procurement role and/or proven experience developing and delivering category strategies. Strong cost analysis capability and supply market intelligence experience. Proficient in reading and understanding technical drawings. Excellent communication skills, able to influence at all levels internally and externally with suppliers.To apply for this Strategic Sourcing Buyer / Strategic Buyer / Category Buyer / Commodity Buyer / Sourcing Buyer / Procurement Specialist / Strategic Procurement job, candidates must be eligible to live and work in the UK

We have a new opportunity for an Internal Sales Executive to join our team at our branch located at BPX Bristol (BS20 7XE). We are looking for a bright, enthusiastic person to join our friendly team. This is a full-time, permanent position, where continuous sales development and training will be provided. About Us: For 60 years BPX (part of the RS Group) has built a reputation as the leading independent distributor of factory automation and control components – from computers to connectors, from robots to relays and everything in between. We now employ over 180 people and from our 15 locations throughout the UK & Ireland, we provide a local service to our customers. Our continued success comes from our passion for technology and commitment to customer service. We are a talented group across our UK and Ireland branch network and work towards our mission for our customers, “help to choose, help to use”. BPX are the strategic partner to market leading brands such as Schneider Electric, Mitsubishi, Omron and many more, offering innovative products, solutions and technical support to thousands of customers UK wide. Internal Sales Executive Job purpose: As a member of our team, you will be responsible for handling customer enquiries, liaising with suppliers and ensuring that our clients receive the highest level of service. By utilising your excellent interpersonal skills, you will develop long term relationships with our customers ensuring that their requirements and business needs are interpreted and handled quickly and effectively. The Internal Sales Executive main duties will include: Answer incoming enquiries to sell and support the company product range. Proactively make outgoing calls qualifying prospects and closing sales in order to meet targets. Accurately process quotations and sales orders using in house systems. Timely administration of quotations using in house quotation software. Ensure customer records are updated frequently and accurately on the Customer Relationship Management Software. Collation of customer files and purchase orders to company standards. Interact with customers to resolve any queries or issues. Provide feedback to the sales team on newly emerging opportunities, proactively assisting as required. Maintain culture of continuous improvement and excellence in customer service. Collate and co-ordinate information requested for management purposes. Any other ad hoc duties required by the Branch Manager.Internal Sales Executive Skills, Knowledge and Experience: To join our team, we are looking for a person who has the following: A proactive/can do attitude towards helping the business grow. A proven track record within a customer service role. Experience of making proactive outgoing telephone calls. A passion for sales Excellent customer interaction skills. Strong organisational, administrative and telephone skills. Ability to prioritise work, meet deadlines and follow through on commitments. Excellent attention to detail such that customer orders and information are accurate. Confident telephone manner. Computer literate (MS Office).BPX offers great benefits such as: Minimum of 31 days annual leave including bank holidays (increasing with length of service) Access to our training and development platform Friendly and supportive work environment Dress down Fridays Access to the Employee Assistance Programme Recruitment referral bonus Opportunities for career progression Cycle 2 Work scheme Ability to carry forward unused holiday Option to purchase additional annual leave Free onsite parking Emergency loansBPX remains a financially secure business, offering the chance to work within a happy, friendly company with some wonderful and talented people. If you like a challenge and believe you are the right person to join our team, please click apply and upload your CV, we look forward to hearing from you! We reserve the right to close the advert early when a suitable candidate is found. No Agencies, please Company Overview We are makers, gamers, craftors, creators and engineers – inspired by transforming clients businesses through experience and design. Our teams mind map, apply research, and inspire. We design, blueprint, build and test. And at the heart of everything we do is our unrelenting drive to design better customer experiences. It fuels our creativity. It’s how we solve business problems. It’s the reason we love rolling up our sleeves and getting down to work – and it’s why we’re so successful. Our roots are solid, our future is digital, our passion is contagious and our people are simply the best. Sound like fun? Then join the family

Technical Sales Executive (Full Training Provided) Avonmouth, Bristol £27,500 - £32,000 + Quarterly Bonus + Health Insurance + Pension + Holiday Excellent opportunity for anyone with sales or customer service experience looking for a technical sales position within the engineering/manufacturing industry. On offer is a role which will provide full technical training on products and a great path of career progression and development. This well-established company provides a range of bespoke technical solutions to clients in the engineering and manufacturing sectors. As part of growth, they aim to enhance their sales team and have a great company culture for developing staff from within. In this role you will work in the office to take on inbound enquiries and provide quotations to customers. You will negotiate, provide exceptional customer service and identify business opportunities. The Person Background in sales or customer service Any background considered Living commutable to AvonmouthThe Role Inbound sales Training in technical products Chasing up quotations No cold callingAll in all, a unique chance to get into a technical industry as an inbound sales executive with great career progression. If you do not hear from us within 10 days, then unfortunately your application has not been successful on this occasion. However, we may keep your details on file for any future suitable vacancies and contact you accordingly. Keywords: Sales, internal, inbound, executive, engineer, technical, customer support, service, electrical, mechanical, manufacturing, IT, graduate, junior, trainee, technical

Job Title: Level 3 Nursery Practitioner Location: Portishead Start Date: Immediate Start Salary: £15.00 - £17.00 Are you a passionate Level 3 Nursery Practitioner looking to join a welcoming and supportive nursery environment? Do you have a caring and nurturing approach to supporting early years development? Are you ready to take the next step in a permanent Nursery Practitioner role? TeacherActive is proud to be working with a warm and welcoming nursery setting in Portishead that is looking to appoint a Level 3 Nursery Practitioner. The nursery provides a safe, engaging, and stimulating environment where children are encouraged to learn through play and exploration, with a strong focus on supporting every child’s individual development. The nursery is looking to take on a dedicated Level 3 Nursery Practitioner on a permanent full-time basis with an immediate start. The successful Level 3 Nursery Practitioner will support children across the Early Years setting, ensuring a safe and positive learning environment while delivering activities in line with the EYFS curriculum and supporting children’s social, emotional, and educational development. The successful Level 3 Nursery Practitioner will have: • Level 3 qualification in Childcare or Early Years, • Experience working within an Early Years or Nursery setting, • Strong knowledge of the EYFS curriculum, • A caring, patient, and enthusiastic attitude, • Excellent communication and teamwork skills, • A proactive and adaptable approach In return for the above you can expect to receive: • Competitive salary and permanent contract, • Supportive management team and welcoming nursery environment, • Ongoing CPD and career progression opportunities, • Access to excellent resources and facilities, • A dedicated consultant to support you throughout the recruitment process If you are interested in this position, then click APPLY NOW and I will be in touch regarding this fantastic opportunity. EMAIL: CONTACT NUMBER: ENTER OFFICE NUMBER HERE About TeacherActive TeacherActive is one of the UK’s leading education recruitment agencies, with over 20 years of experience supporting schools and education professionals. We place teachers and support staff into a wide range of temporary, contract and permanent roles, helping candidates find rewarding opportunities that suit their experience, availability and career goals. We pride ourselves on providing an excellent service to both our schools and candidates. Equal Opportunities Statement TeacherActive is an equal opportunities employer and operates as an Employment Business and Employment Agency in providing temporary, contract and permanent job seeking services. Safeguarding and DBS Compliance Registration may involve an enhanced DBS check, ID checks and the supply of good professional references, depending on the role. We are committed to safeguarding and compliance across all placements. Regular external audits have shown repeatedly that our standards are exceptional. We are passionate about finding the right staff for each education environment

My client, a market leading MEP and Sustainability Consultancy based in Clevedon searching for a BIM Technician to join their specialist team. This is a hybrid role, offering varied residential, commercial and industrial projects. As BIM Technician you will join a bespoke team based in Clevedon. Candidates are required to live locally to work from the office. You will be trained and supported by an experienced team and have the chance to complete electrical and mechanical designs for major residential, commercial, healthcare, leisure and retail schemes using Revit. As a BIM Technician you will be expected to complete mechanical, electrical and building services designs using Revit. You will also be supported to complete; • 3D design of Mechanical, Electrical and Public services. -Design to BIM level 2 in accordance with British Standards PAS 1192-5. -Create to scale surveys of existing buildings. -Create feasibility and condition reports for future works and liaise with Trades, Engineers, Architects and Surveyors for on-going projects. -Run clash detection on designs before process to Architects and field engineers. This role offers a competitive salary, private medical care, travel expenses for business meetings, pension scheme, flexible working (hybrid) and generous annual leave. As a BIM Technician you are required to have a HNC/HND/BSc or MSc Mechanical Engineering or Building Services Engineering and have experience working for UK based Consultancy completing detailed electrical, mechanical and building services designs for buildings and commercial developments using Revit. You are also required to have a detailed knowledge PAS 1192-5 and other relevant codes. Candidates are required to have a valid UK driving licence to visit sites. If this role is of interest to you, please contact Jordanna Morris at Aztrum Recruitment

Saw Operative - Avonmouth (BS11) £15.90 per hour | Temp to Perm | Career Progression | Engineering & Manufacturing Are you an experienced Saw Operative looking for a long‑term opportunity in a busy engineering and manufacturing environment? Our client in Avonmouth (BS11) is expanding and seeking skilled operatives with experience using band saws, circular saws, or bar saws. This is a fantastic chance to secure a stable role with excellent training and progression. Job Overview Location: Avonmouth, Bristol (BS11) Pay: £15.90 per hour (weekly pay) Hours: Rotating shifts - 6am-2pm / 2pm-10pm (Mon-Fri) Contract: Temporary to Permanent Industry: Engineering, Manufacturing, Metal Cutting Progression: Full training + long‑term development Key Responsibilities Operating saws to cut metal materials to precise customer specifications Using band saws, with circular saw or bar saw experience also welcomed Completing general warehouse and production duties Maintaining accuracy, quality, and safe working practices at all times Following all company procedures and production guidelines Candidate Requirements Previous experience as a Saw Operative, Machine Operative, or Metal Cutter Experience operating band saws (metal cutting preferred) Comfortable working in a warehouse or production environment Strong attention to detail and ability to follow instructions Reliable, hardworking, and able to work rotating shifts Why This Role Stands Out Competitive hourly rate of £15.90 Temp‑to‑perm role offering long‑term job security Excellent training and clear progression pathway Supportive team within a well‑established engineering business Consistent full‑time hours on rotating shifts How to Apply If you're an experienced Saw Operative or Machine Operative looking for a secure, long‑term role in Avonmouth, apply now and we'll contact you to discuss your application. Should you require any support or assistance, please contact your local Gi Group office. Gi Group Holdings Recruitment Limited are proud founding members of Menopause in business, corperate members for Neurodiversity in business, Disability Confident committed members, Gold status for the Armed Forces Covenant, Bronze trail blazers for Racial Equality matters and Age Freindly Employer pledge members. Gi Group Holdings Recruitment Limited group of companies includes Gi Recruitment Limited, Draefern Limited, Gi Group Recruitment Ltd, INTOO (UK) Limited, Marks Sattin (UK) Limited, TACK TMI UK Limited, Grafton Professional Staffing Limited, Encore Personnel Services, Gi Group Ireland Limited and Kelly Services (UK) Ltd. Gi Group Ireland Limited are acting as an Employment Agency in relation to this role. We are committed to protecting the privacy of all our candidates and clients. If you choose to apply, your information will be processed in accordance with the Gi Group Privacy Statement. To view a copy and to help you understand how we collect, use and process your personal data please visit the Privacy page on our Gi Group website

Saw Operative - Avonmouth (BS11) £17.31 per hour | Temp to Perm | Excellent Career Progression Are you an experienced Saw Operative looking for a long-term role with genuine development opportunities? We are recruiting for a leading engineering and manufacturing business based in Avonmouth, Bristol (BS11). If you have experience using band saws, circular saws, or bar saws, this is a fantastic opportunity to join a growing and supportive team. Job Details Location: Avonmouth, Bristol (BS11) Pay Rate: £17.31 per hour Hours: Monday-Friday 10pm-6am Contract Type: Temporary to Permanent Progression: Clear training and long-term career development Key Responsibilities Operating saws to cut metal materials to customer specifications Using band saws, with circular saw or bar saw experience also welcomed Carrying out general warehouse and production duties as required Ensuring accuracy, quality, and safe working practices at all times Requirements Previous experience operating saws (metal cutting preferred) Comfortable working in a warehouse or production environment Excellent attention to detail and ability to follow instructions Reliable, hardworking, and able to work rotating shifts Why Work With Us? Competitive hourly rate of £17.31 per hour Temp-to-perm opportunity offering long-term stability Full training and a clear pathway for career progression Supportive team environment How to Apply Apply online today, or contact Gi Group Bristol for more information: ? (phone number removed) Should you require any support or assistance, please contact your local Gi Group office. Gi Group Holdings Recruitment Limited are proud founding members of Menopause in business, corperate members for Neurodiversity in business, Disability Confident committed members, Gold status for the Armed Forces Covenant, Bronze trail blazers for Racial Equality matters and Age Freindly Employer pledge members. Gi Group Holdings Recruitment Limited group of companies includes Gi Recruitment Limited, Draefern Limited, Gi Group Recruitment Ltd, INTOO (UK) Limited, Marks Sattin (UK) Limited, TACK TMI UK Limited, Grafton Professional Staffing Limited, Encore Personnel Services, Gi Group Ireland Limited and Kelly Services (UK) Ltd. Gi Group Ireland Limited are acting as an Employment Agency in relation to this role. We are committed to protecting the privacy of all our candidates and clients. If you choose to apply, your information will be processed in accordance with the Gi Group Privacy Statement. To view a copy and to help you understand how we collect, use and process your personal data please visit the Privacy page on our Gi Group website

About Us At Anglian we are a leading home improvement company committed to providing high-quality Windows, Doors, Conservatories and Roof line products and exceptional customer service. Our success is built on innovation, dedication, and a customer-first approach. Join us to make a real impact in an exciting business. The Role We are currently seeking a Field Manager to join our team. You will be at the heart of our daily operations, field based, leading and organising our self - employed Installation teams, inspecting works completed. At all times providing first class service to our customers to ensure that installations are completed within agreed timescales and to Anglian's quality standards. Key Responsibilities Deliver an exceptional customer experience, adhering to Anglian standards Monitor 6-7 installation teams to ensure timely and quality installations. Provide support to installation teams to develop their skills and performance. Handle customer installation queries or issues in a professional and timely manner thus enabling prompt account settlement upon completion of the job. Ensure that installations are completed in line H&S standards. What We’re Looking For Knowledge of installation processes and best practices. Good On – Site presence; interpersonal skills, comfortable talking to customers. Previous experience in a similar role within the home improvement or construction industry. Strong organisational abilities with a keen attention to detail. Valid driver's licence to travel as required within the region. Why Join Us? Competitive salary Pension Company Car 31 days holiday (including Bank Holidays and increasing to 33 days with service within 2 years). An additional paid day for your birthday Paid time off annually to volunteer Comprehensive health & well-being benefits including access to in-house occupational health & well-being resources, discounted gym memberships, employee assistance programme, & mental health resources. Heavily discounted employee purchase scheme on all Company products Group perks & discounts on most major high street retailers including food shopping, days out, cinema, theatre, dining, mobile phones Salary sacrifice benefits – enjoy perks such as pension, cycle to work, electric car purchase, and additional annual leave, while potentially reducing your tax and NI contributions Access to extensive financial well-being resources including flexible pay and competitive savings & borrowing products Employee recognition schemes Take the next step in your career by applying today! Important Information About Right to Work We’re delighted that you’re considering joining our team. For this role, applications will only be accepted from individuals who already have the right to work in the UK, or who can independently secure this right. This position does not meet the Home Office requirements for employer visa sponsorship. If you’re unsure about your eligibility, you can find helpful information on the UK government website. Thank you for your understanding Our Company is committed to monitoring & aligning its Policies with up-to-date Government guidance on reducing the spread of respiratory infections in the workplace. Through the Company’s value of “Succeed Together” we are committed to Equality, Diversity and Inclusion. We recruit the ‘best person for the job’ regardless of any protected characteristics as defined by the Equality Act 2010 creating an inclusive working environment and culture for our employees

CBRE Global Workplace Solutions is a leading global provider of integrated facilities and corporate real estate management. We are recruiting a Technical Facilities Manager for our site based in Nailsea. As a CBRE Technical Facilities Manager, you will manage many functions of building operations and maintenance for a facility, campus, or portfolio of buildings. This job is a part of the Facilities Management functional area which focuses on all aspects of the operations of a set of assets, providing support to the Property Managers regarding all repairs and investment plans. What You'll Do: · Provide formal supervision to employees. Track the training and development of staff. Conduct performance evaluations and coaching. Oversee the recruiting and hiring of new employees. · Coordinate and manage the team's daily activities. Establish work schedules, assign tasks, and cross-train staff. Set and track staff and department deadlines. Mentor and coach as needed. · Coordinate and manage facility repairs and maintenance by working with technicians, vendors, and contractors. · Maintain positive client relationships and conduct meetings on unresolved facility issues. · Prepare and manage large and high-profile capital projects, operating budgets, and variance reports. · Perform facility inspections quality assurance following local, state, and federal regulations. Suggest and implement operational efficiencies, repairs, and upgrade opportunities. · Create environmental health and safety procedures for facilities. · Develop vendor relationships and oversee invoicing procedures. Review and approve purchase orders for the procurement of parts, services, and labor for projects. · Apply a broad knowledge of the business, own discipline, and how own discipline integrates with others to achieve team and departmental objectives. · Lead by example and model behaviors that are consistent with CBRE RISE values. Influence others to adopt a different point of view while being guided by policies and departmental plans. · Identify and solve technical and operational problems of complexity. · Understand and recognize the broader impact across the department. · Improve and change existing methods, processes, and standards within job discipline. What You'll Need: Recognised Level 3 Qualification in Mechanical & Electrical Engineering or similar Bachelor's Degree preferred with 5 - 8 years of relevant experience. In lieu of a degree, a combination of experience and education will be considered. Valid driver's license required. Facility Management certification preferred. Experience in the areas of staffing, selection, training, development, coaching, mentoring, measuring, appraising, and rewarding performance and retention is preferred. Ability to lead the exchange of sensitive, complicated, and difficult information, convey performance expectations and handle problems. Leadership skills to motivate the team to achieve broad operational targets with impacts on own job discipline, multiple job disciplines, and department. In-depth knowledge of Microsoft Office products. Examples include Word, Excel, Outlook, etc. Extensive organizational skills and an advanced inquisitive mindset. Intermediate math skills. Ability to calculate complicated figures such as percentages, fractions, and other financial-related calculations. Why CBRE When you join CBRE, you become part of the global leader in commercial real estate services and investment that helps businesses and people thrive. We are dynamic problem solvers and forward-thinking professionals who create significant impact. Our collaborative culture is built on our shared values - respect, integrity, service and excellence - and we value the diverse perspectives, backgrounds and skillsets of our people. At CBRE, you can chart your own course and realize your potential. We welcome all applicants. Applicant AI Use Disclosure We value human interaction to understand each candidate's unique experience, skills and aspirations. We do not use artificial intelligence (AI) tools to make hiring decisions, and we ask that candidates disclose any use of AI in the application and interview process. Our Values RESPECT: We act with consideration for others' ideas and share information openly to inspire trust and encourage collaboration INTEGRITY: No one individual, no one deal, no one client, is bigger than our commitment to our company and what we stand for SERVICE: We approach our clients challenges with enthusiasm and diligence, building long-term relationships by connecting the right people, capital and opportunities EXCELLENCE: We focus relentlessly on creating winning outcomes for our clients, employees and shareholders About CBRE Global Workplace Solutions: As one of CBRE's core global businesses, Global Workplace Solutions (GWS) provides end-to-end services to occupier clients across the entire lifecycle of a building. Our teams help companies improve their operations and reduce costs, through expert facilities management, project management, real estate and energy and sustainability services. Our dedicated teams work across all industries, and support clients ranging from global Fortune 500 companies to single, iconic buildings. CBRE Group, Inc. is the world's largest commercial real estate services and investment firm, with 2019 revenues of $23.9 billion and more than 100,000 employees (excluding affiliate offices). CBRE has been included on the Fortune 500 since 2008, ranking #128 in 2020. It also has been voted the industry's top brand by the Lipsey Company for 19 consecutive years and has been named one of Fortune's "Most Admired Companies" for eight years in a row, including being ranked number one in the real estate sector in 2020, for the second consecutive year. Its shares trade on the New York Stock Exchange under the symbol "CBRE." Application Process: Your application will be reviewed by our Talent Resourcing Team, and you will be contacted if you have been successful in being short listed for the role. Taking into consideration the costs of sponsorship, the nature of the role and the financial resources of the account in question, we are unable to offer sponsorship for this role. No agencies please. Please note: the job title shown above may be different to local job titles used in our business and issued on any contract of employment. #GWSEMEA

HGV CLASS 2 DRIVER Location: Bristol CompetitivePay +OvertimeAvailable Full-Time |Permanent/Contract Looking forsteady, well-paid driving workwith an immediate start? Were hiring experiencedHGV Class 2 Driveron behalf of a leading commercial relocations companyto join a busy and friendly transport team in Bristol. Whether youre looking forongoing workorapermanent role, this is a great opportunity withconsistent hoursandweekly pay. This is an excellent opportunity to join a well-established business delivering professional office and corporate relocation services. The role offers stable work on a flexible basis,regular overtime opportunities, and the chance to work as part of a professional relocation team supporting major corporate clients. If you are an experiencedClass 2 Driverlooking for a varied role beyond standard delivery driving, this could be the perfect opportunity. The Role: As anHGV Class 2 Driver, you will be responsible for the safe transportation of office furniture, IT equipment, and commercial assets between client locations across London. You will also work closely with the relocation teams to support office moves and installations. Key Responsibilities: DrivingHGVClass2 vehiclessafelyandefficiently in and around London andacross the South of the UK. Transportingofficefurniture,ITequipment,andbusinessassets Assistingwithloadingandunloadingvehiclesaspartoftherelocationteam Ensuringgoodsaresecuredandprotectedduringtransit Carryingoutdailyvehiclechecksanddefectreporting Completingdeliverypaperworkandjobdocumentation Providingaprofessionalservicewhenworkingonclientsites Followinghealth &safetyproceduresandmanualhandlingguidelines WhatWe'reLookingFor: ValidHGVClass2 (CategoryC)licence Driver CPC Qualification Digital Tachograph Card Goodlevelofphysicalfitness(roleinvolvesmanualhandling) Reliable,professional,andteam-orientedattitude Flexibilityforearlystarts What WeOffer: Competitivesalary Flexible,permanentemployment Traininganddevelopmentopportunities CompanyuniformandPPE Opportunitytoworkwithawell-establishedcommercialrelocationspecialist APPLY NOW IfyouareareliableHGVClass2Driverlookingforalong-termopportunitywithafantastic company,wewouldlovetohearfromyou. TPBN1_UKTJ

Procurement Administration Assistant Reporting To The Procurement Administration Assistant will report to the Lead Buyer and Procurement Manager and will work closely with all departments across the business, as well as external suppliers and service providers. Role Overview The Procurement Administration Assistant plays a key role in supporting the smooth and efficient operation of the procurement function. Working collaboratively with internal departments and suppliers, the role is responsible for raising purchase orders, maintaining procurement records, supporting supplier administration, and ensuring purchasing processes are completed accurately and on time. The successful candidate will help ensure continuity of supply by supporting the purchase of goods, materials, and services while considering quality, cost, and delivery requirements. As part of the Employee Ownership culture, all employees are expected to contribute to the continued success of the business by demonstrating accountability, collaboration, and a commitment to delivering excellent customer service. Employee Ownership Expectations As a partner, you will share in both the responsibilities and rewards of ownership. Employees are expected to: Take responsibility for delivering exceptional customer experiences and contributing to business profitability Work collaboratively as part of a team, embracing the Core Values Take opportunities for personal development and continuous improvement Support a positive work-life balance and provide support to colleagues where needed Promote and actively support Employee Ownership and culture Key ResponsibilitiesProcurement Administration Raise purchase orders for low-value, repeat, and routine purchases Process office supply orders and other day-to-day purchasing requirements Maintain accurate procurement records, documentation, and filing systems Support contract administration and document management activities Assist with resolving invoice queries and liaising with suppliers where required Ensure procurement systems, databases, and records are kept accurate and up to date Supplier Administration • Coordinate supplier onboarding and setup administration, • Manage supplier compliance documentation, records, and forms, • Maintain accurate supplier information and update records as necessary, • Liaise with suppliers regarding administrative queries and documentation requests Data Entry & Administrative Support • Carry out accurate data entry across procurement systems and spreadsheets, • Maintain purchasing records and supplier information, • Organise and update procurement files and documentation, • Provide general administrative support to the Procurement team Team Support • Provide day-to-day administrative support to the Procurement Manager and Buyers, • Support continuous improvement initiatives to streamline procurement processes, • Help maintain strong communication and collaboration with internal stakeholders Key Performance Indicators (KPIs) • Purchase Order accuracy, • Timely processing of purchase orders, • Accuracy and maintenance of procurement records, • Supplier documentation compliance, • Responsiveness to internal and supplier queries Qualifications & Knowledge • Previous administration experience, ideally within a procurement or manufacturing environment, • Understanding of purchasing processes within a manufacturing business, • Awareness and understanding of GDPR requirements, • Knowledge of procurement systems and procedures is advantageous Skills & Experience Experience using MRP/ERP systems Strong organisational and time management skills Excellent attention to detail and accuracy Strong communication and interpersonal skills Proficient in Microsoft Office, particularly Excel Ability to manage multiple tasks and prioritise workload effectively Ability to work independently and as part of a team Personal Attributes & Behaviours Customer-focused with a proactive approach Demonstrates Core Values and acts as a positive role model Collaborative problem solver with a team-oriented mindset Uses initiative and works proactively Organised, flexible, and adaptable Committed to Continuous Professional Development (CPD) Strong verbal and written communication skills High level of accuracy and attention to detail Professional, reliable, and approachable attitude

Technical Author Clevedon, North Somerset (Hybrid Working) Salary up to £43,000 per annum + company bonus up to 7.5% + extensive benefits package Our client is a global engineering and manufacturing organisation seeking an experienced Technical Author to join their team based in Bristol. This is an excellent opportunity to work within a highly technical environment, producing high-quality customer documentation for complex engineered products used worldwide. This hybrid role offers the flexibility to split your time between remote working and onsite collaboration at the Clevedon office. The Role As Technical Author, you will be responsible for producing and maintaining clear, accurate, and compliant technical documentation to support customers and internal stakeholders globally. Working closely with engineers, subject matter experts, and manufacturing teams, you will ensure all documentation is produced to a consistently high standard. Documentation will include: ·Instruction manuals ·Spare parts manuals ·Addendums ·Declarations of Conformity ·Product support documentation Key Responsibilities ·Plan, research, write, edit, and deliver technical documentation from concept through to release ·Produce clear, concise, and well-structured procedures and technical instructions ·Create and manipulate photographs and technical illustrations to support written content ·Gather technical information through collaboration with engineering teams and subject matter experts ·Review, proofread, and amend documentation to ensure accuracy and consistency ·Ensure all documentation complies with relevant industry standards and directives ·Work independently while effectively managing multiple priorities and deadlines About You To be successful in this role, you will ideally have: ·A degree, HNC/HND qualification, apprenticeship, military engineering background, or equivalent experience in mechanical or electromechanical engineering ·Proven experience as a Technical Author within an engineering or manufacturing environment ·Experience producing instruction manuals for complex technical products ·Experience using XML authoring tools ·Good understanding of Component Content Management Systems (CCMS) ·Strong Microsoft Office and SharePoint 365 skills ·Experience using image manipulation software such as CorelDRAW ·The ability to interpret mechanical drawings, electrical schematics, and technical data ·Excellent attention to detail and organisational skills ·Strong communication skills with the ability to work effectively with stakeholders and SMEs What’s on Offer ·Salary up to £43,000 per annum ·Company bonus up to 7.5% ·Extensive and generous benefits package ·Hybrid working arrangement ·Career development and ongoing learning opportunities ·Collaborative and innovative working environment ·Opportunity to work within a global engineering organisation Diversity & Inclusion Our client is committed to creating an inclusive workplace where everyone feels valued, respected, and supported. Applications are welcomed from candidates of all backgrounds, experiences, and perspectives. We believe diversity drives innovation and strengthens teams. Apply Now If you are an experienced Technical Author looking for your next opportunity within a highly technical engineering environment, we would love to hear from you. This vacancy is being advertised by an Employment Agency and Employment Business

This role supports the smooth operation of the head office and offers a Level 3 Business Administrator Apprenticeship or a 2-year fixed-term contract for those not pursuing an apprenticeship. AVON LMC LTD is looking for a Business Services Administrator for its Bristol office. Key duties include fro

Unity is advertising this opportunity on behalf of our client.All applications will be directed to our client.Are you an experienced cleaner looking for flexible work that fits around your life?.Whether you’re looking to fill gaps between other jobs or build a full-time income on your terms, this

We're currently looking for individuals across the country to take part in remote paid research, including remote focus groups, product trials, and consumer studies.Earn up to £700 a week in your free time by providing feedback on everyday products and services.If you're comfortable sharing your op

Unity is advertising this opportunity on behalf of our client.All applications will be directed to our client.Are you an experienced cleaner looking for flexible work that fits around your life?.Whether you’re looking to fill gaps between other jobs or build a full-time income on your terms, this

Unity is advertising this opportunity on behalf of our client.All applications will be directed to our client.Are you an experienced cleaner looking for flexible work that fits around your life?.Whether you’re looking to fill gaps between other jobs or build a full-time income on your terms, this

We're currently looking for individuals across the country to take part in remote paid research, including remote focus groups, product trials, and consumer studies.Earn up to £700 a week in your free time by providing feedback on everyday products and services.If you're comfortable sharing your op

Veterinary Receptionist - Bristol.If you enjoy delivering excellent customer service and working as part of a supportive team, we have a fantastic opportunity for you at our Bristol Imperial Vets for Pets practice.What your typical day will look like:.Providing outstanding service to our clients whi

Accommodation Cleaner - Hayling Island - Hayling Island, Hampshire .Job title – Accommodation Cleaner.Location – Meadow Bay Villages, Hayling Island Holiday Park, Hayling Island, PO11 0QS.Part Time, Seasonal, Mondays & Fridays with possible overtime.We are looking for part time accommodation