Corporate office jobs in BristolCreate job alerts

Corporate Tax Senior Manager, CTA, ACA, Part Remote, Bristol Corporate Tax Senior Manager required to work for an exciting and growing practice in Bristol. This will be part remote and part office based. We need someone who is already at Senior Manager level and who is prepared to move into a kind of side-step move but with a view to being fast tracked to the next level in your career. This is a nic... ZIPC1_UKTJ

Hays are looking to recruit a Financial Accountant on a 12-month FTC. Your new company A large Bristol employer is looking to recruit a technically strong Financial Accountant to join the team on a 12-month FTC. Your new role Sitting as part of the business transformation team, we are looking for someone to help support the Corporate Restructuring of the Group, streamlining complex corporate structures and processes to improve efficiencies, reduce costs and strengthen governance. The role will include: • Finance business partner across all areas of the finance function to ensure all projects are on time and on track., • Lead on the day-to-day legal merger activity across the business., • Coordinate external legal and tax advice, including provision of financial and tax information with analysis where required., • Review and approval of accounting entries to ensure accuracy in their systems of record, • Adherence to statutory and tax regulatory requirements. What you'll get in return The role is being offered as a 12-month FTC to start ASAP. The team require in office working a maximum of 2 days per week from their modern offices, with parking available and close to local train links. The role offers a salary and an end-of-year bonus. What you need to do now If you're interested in this role, click 'apply now' to forward an up-to-date copy of your CV, or call us now. If this job isn't quite right for you, but you are looking for a new position, please contact us for a confidential discussion about your career. 4795639

Join a leading independent technology and services provider as a technician 3 Job Overview: We are seeking an experienced Tech 3/Senior Deskside Support Engineer to work on-site as part of a collaborative support team in Bristol. The successful candidate will provide high-quality desk side support, handling incidents and service requests in a Wintel environment, with a strong focus on end-user satisfaction and SLA adherence.As a lead engineer, you will also be responsible for guiding and supporting junior team members, ensuring tickets are updated accurately and processes are followed, while working closely with a remote Team Leader. Location: 3 Golf Course Lane, Bristol Daily Rate: £19.85/hr - PAYE, £25.75/hr - UMB Contract Length: 10th May 2026 till 31st December 2026 Key Responsibilities • Provide desk-side support for incidents and requests at the Bristol site, • Support and troubleshoot Windows 10/11, Microsoft Office, and Wintel environments, • Diagnose and resolve hardware break/fix issues on HP laptops and desktops, • Support mobile technologies, including Apple (iOS) and Android devices, • Provide user support for Skype and related collaboration tools, • Act as a lead engineer, supporting and guiding the on-site team, • Ensure all tickets are updated accurately and resolved within SLA, • Follow, maintain, and update IT processes and procedures as required., • Identify opportunities for continuous improvement to enhance customer experience, • Contribute to the creation and maintenance of knowledge base articles and documentation, • Build effective relationships with colleagues, wider support teams, and business partners, • Proven experience in Senior Deskside/Tech 3/On-site IT Support roles, • Strong experience handling Incidents & Service Requests in an ITSM environment, • Excellent knowledge of Microsoft Windows 10/11 and MS Office Suite, • Hands-on experience with desktop & laptop build, configuration, and troubleshooting, • Experience supporting HP hardware in a corporate environment, • Knowledge of mobile device support (Apple iOS and Android), • Strong understanding of ITIL-aligned processes and SLA management, • Excellent problem-solving skills with strong attention to detail Hays Talent Solutions is a trading division of Hays Specialist Recruitment Limited and acts as an employment agency for permanent recruitment and employment business for the supply of temporary workers. By applying for this job you accept the T&C's, Privacy Policy and Disclaimers which can be found on our website.

Senior Java Engineers (12x) — Contract - (Financial Services / Investment Management) • Location: Remote First, • Engagement Type: Contract, • IR35 Status: Outside IR35, • Day Rate: £600 - £700 Per Day (Monthly Pay) Our client is a leading UK investment management platform currently undertaking a major back-office transformation programme. The programme centres on the integration of a third-party institutional custody and clearing platform, replacing legacy back-office infrastructure with a modern, cloud-native architecture built to handle high-throughput financial operations across settlement, custody, corporate actions processing, and reconciliation. The programme is multi-year, well-funded, and operating at pace. Engineers joining at this stage will be working on technically complex integration and platform problems with real impact across the business. Role Overview We are seeking multiple Senior Java Engineers to join the programme engineering team. You will be responsible for designing and delivering robust, high-performance Java services that integrate with both the incoming custody platform and existing internal systems. You will work within cross-functional agile squads and are expected to contribute from day one with minimal ramp-up. Key Responsibilities: • Design, develop, and deliver high-quality Java microservices in support of back-office platform integration, • Build and maintain RESTful and event-driven APIs supporting settlement, reconciliation, corporate actions, and custody workflows, • Integrate with third-party financial platform APIs and messaging systems, • Contribute to technical design discussions, architecture reviews, and solution documentation, • Write clean, well-tested, production-grade code with appropriate unit, integration, and contract testing coverage, • Participate in code reviews and uphold engineering standards across the squad, • Identify and resolve performance, reliability, and scalability issues, • Work closely with business analysts and platform specialists to understand domain requirements and translate them into technical implementations, • Support DevOps practices including CI/CD pipeline maintenance, deployment automation, and cloud infrastructure management Skills and Experience • Strong, demonstrable experience as a Senior Java Engineer in a production environment, • Proficiency in Java 11+ with Spring Boot, Spring Cloud, and associated ecosystem tooling, • Solid understanding of microservices architecture, RESTful API design, and event-driven patterns, • Hands-on experience with AWS (minimum two of: ECS, Lambda, SQS/SNS, RDS/Aurora, S3, API Gateway, CloudWatch), • Experience with message streaming platforms, preferably Apache Kafka, • Competency with containerisation using Docker and orchestration via Kubernetes, • Strong unit and integration testing discipline (JUnit, Mockito, contract testing), • Familiarity with CI/CD tooling (Jenkins, GitHub Actions, or equivalent), • Experience working in agile delivery environments within complex, multi-team programmes This role is being managed exclusively by a specialist FS technology contract recruitment consultancy. All applications will be handled in strict confidence.

Are you struggling to get over the line with your APC training? Are you working for a large corporate and looking for something a bit different? Do you want to work in the city centre? An exciting opportunity has arisen to join an established consultancy with a national presence based in Bristol. This company, established over 50-years' ago employ 50 staff across three regions. They have an existing Bristol office and have recently relocating to larger premises in the city centre to support their growth and presence in the South West. Some key points include: • Suited to a candidate who is struggling to get the range of experience or critical analysis project to pass their APC interview. The practice are focused on delivering quality, therefore there is a emphasis on training and becoming chartered. Two existing team members have passed their APC interview in the past 12-months (both first time)., • Working directly with the National Head of Building Surveying (also based in Bristol) and part of a national department of seven., • Regional and national client base (mix of professional and project work) - instructions will mainly be along the M4 corridor and South Wales., • Flat management structure where you will have access to the owners of the business., • Lots of company investment in building surveying services with further expansion plans., • Excellent employee retention - many have worked for the business for 10+ years. The hiring manager is looking for an individual with a minimum 12-months post degree experience and either working towards final assessment with the RICS or just achieved chartered status. Employee benefits include; 25 days holiday (plus additional 3 days at Christmas), private healthcare (after successful completion of probation period), life insurance, local car parking permit, flexible working and working from home options. The provision of a car allowance will be considered. The package will also be immediately reviewed once achieved chartered status, which will likely be £40,000 to £45,000 (basic salary) plus car allowance. Your application will be dealt with in the strictest confidence by Matthew Clackson. Please call our office on 07825 081 393 or alternatively send your CV directly to , and for many more property jobs please visit our website .

Oculus Legal Group has been instructed to hire of a Senior level Residential Conveyancing to join a Bristol based firm which is highly regarded as having one of the finest Residential teams in the region. The role is pitched at the upper end of the team structure - a role that rarely goes out to the open market for applications. A super opportunity for a licensed conveyancer to thrive in a collaborative and 'down to earth' culture. The Opportunity: Say 'goodbye' to time recording, micro-management and targets - as a senior level Residential Conveyancer it will be understood that none of these tools will be appealing - these elements therefore do not exist with this role. The role will report into a vastly experienced Partner who has been with the firm for over 20 years'. The Partner is incredibly knowledgeable, truly a lovely person who is a readily available escalation point when required. The capabilities of our client's Residential Conveyancing team is very broad with strong cross-office collaboration. Upon joining the team - the opportunity will present itself for exposure to be secured across Freehold & leasehold, sales & purchases, Shared ownership, Auction sales & purchases, Mortgages and equity release, The granting of new leases, Transfers of equity, Landlord & tenant matters, Lease extensions, Right to Buy, Help to Buy and Boundary disputes. Hopefully the opportunity to still learn, despite being a senior member of the team. Working as part of a collaborative team, you will benefit from varied and interesting residential work. What’s needed to be considered? • Possess prior residential conveyancing experience, • Excellent client management skills, • Ability to manage simultaneous residential files, • Accomplished administration skills, • Be a team player, • Enjoy working in a busy environment, • Ability to prepare completion statements, stamp duty land tax forms and dealing with post-completion matters through to registration of title, • Keeping up to date with developments in residential property law What's on offer to you? Salary up to £52,000 25 days annual leave (plus Bank holidays) Exceptional bonus scheme Company pension scheme Strong work/lifestyle balance - non corporate environment What next? Apply today to be considered for this opportunity. If suitable, one of our specialist consultants will be in contact to discuss the opportunity with you in detail prior to submitting your CV to the client. In this discussion we will aim to identify your specific skills and motivations, and where appropriate recommend other relevant opportunities to you that match your requirements. Additionally, refer a friend or colleague to us and receive £200 in vouchers if we assist them in securing a new career. Job Synonyms: • Residential Conveyancer, Residential Conveyancing, Residential Property

Legal Counsel 1+pqe guide Our client is a global leader operating within the industrial and manufacturing sector. As part of an established in house legal function, you will provide a wide variety of commercial legal advice within a dynamic and complex business environment. We are looking for a versatile Commercial/Corporate lawyer with a commercial approach. Key responsibilities • Act as a key contact for stakeholders in a range of business units and corporate support departments to help influence and implement business strategy and direction., • Act as a primary contact for the UK sales subsidiary providing day‑to‑day advice to sales and marketing colleagues., • Review, draft and negotiate high-value, complex commercial contracts with customers, sales intermediaries, suppliers, service providers and other key business partners., • Corporate Support/Assist with M&A, • Support the business with responses to tenders and customer queries., • Support on L&S change and process improvement projects that underpin the business’s key objectives across multiple disciplines., • Support operational and commercial functions with day-to-day legal queries and issues., • Work with product development teams to ensure compliance with commercial and IP frameworks., • Assist in maintaining the L&S team’s templates, precedents and other know-how materials., • Provide practical solutions to complex legal problems as a key business partner., • Support senior lawyers as required, both in the UK and internationally. Key requirements • Qualified solicitor (UK) with 2 - 5 pqe and experience in delivering pragmatic, commercial legal advice in a demanding private practice or in-house environment., • Excellent drafting commercial contracts experience, • Strong interpersonal and relationship building skills, • Corporate Experience, • High quality training in a UK Private Practice Desirable • Working in house – ideally within the manufacturing or industrial sectors, • Mergers and acquisitions, • Real estate and property, • Construction, • Software licensing and AI, • Contract management and other legal tools **This is a role requiring office presence 3 days per week. The offices are easily commutable from Bristol.

Senior Talent Acquisition Partner Location: Bristol (Hybrid – 3 days onsite, 2 remote) Type: Permanent, Full Time The Role We’re looking for a Senior Talent Acquisition Partner to scale hiring across Sales, Account Management, Operations, and Central Functions. This is a high-impact, delivery-led role with full ownership of end-to-end recruitment and process excellence. You’ll deliver high-quality hiring while designing and embedding scalable, best-in-class recruitment processes across the UK and APAC. Working with senior stakeholders, you’ll bring structure, pace, and consistency, building repeatable workflows that drive both efficiency and quality. About You You’re a high-performing TA professional who combines strong delivery with process ownership in fast-paced environments. You bring: • Experience hiring across multiple functions (Sales, Marketing, Ops, Corporate), • Strong end-to-end ownership of recruitment processes, • Proven ability to build and embed scalable hiring processes, • Confidence influencing senior stakeholders across regions (UK/APAC), • A highly organised, quality-driven approach with a focus on pace and consistency Experience: • 5+ years in Talent Acquisition (agency and/or in-house), • Experience in high-growth environments, • Strong ATS, reporting, and sourcing capability (LinkedIn Recruiter, direct sourcing) Key Responsibilities • Own and deliver full-cycle hiring across multiple functions, ensuring speed, quality, and consistency, • Design, implement, and embed scalable recruitment processes, including interview frameworks and scorecards, • Build repeatable, high-performing hiring workflows across UK and APAC, • Partner with senior stakeholders to define hiring needs, challenge briefs, and improve decision-making, • Lead proactive sourcing strategies, building and engaging high-quality talent pipelines, • Own recruitment reporting, pipeline tracking, and use data to drive improvements, • Deliver a strong end-to-end candidate experience and promote the company brand, • Identify inefficiencies and continuously improve hiring processes, driving operational excellence, • Contribute to building a structured, high-performing Talent Acquisition function Why Join? • Shape and scale hiring across multiple functions and regions, • High visibility with direct impact on business growth, • Ownership of both delivery and TA best practice, • Fast-paced, ambitious environment where quality and pace matter What’s in It for You • Work with an ambitious, collaborative, and growing team., • £25 monthly wellbeing allowance (e.g. gym membership)., • Matched pension, • Paid training for career accreditations., • Internal mobility options and established career paths., • Incentive schemes and company pension contributions., • Hybrid working (minimum 3 days in Bristol office). The Hybrid Difference We don’t just run ads, we create change. Join us in driving innovation in how education brands reach and inspire the students who will shape tomorrow. Hybrid Media is proud to be an equal opportunities employer. We celebrate diversity and are committed to creating an inclusive environment where everyone feels valued, supported, and empowered to reach their full potential - regardless of background, identity, or circumstance. We welcome applications from all qualified individuals and believe that a diverse team brings richer perspectives, stronger creativity, and better outcomes for our people and our clients. If you’re excited about this role but feel you don’t meet every single requirement, we’d still love to hear from you. Please reach out to our Recruitment Team () to discuss your experience or to enquire about other opportunities across our growing business.

FINANCIAL PLANNER – GROWTH ROLE £SIX FIGURE BASIC | SIGNIFICANT BONUS POTENTIAL | BRISTOL | LEADING WEALTH MANAGER If you are a Financial Planner who genuinely enjoys winning new business, someone who is energised by building relationships, opening doors, and growing a client base, then this role is one to take note of... My client is one of the UK's most respected wealth management businesses are looking for a growth-focused Financial Planner to join their team. You will hit the ground running with a partial portfolio of existing HNW clients to build from, and then grow that book significantly through professional introducer relationships, internal referrals from Investment Managers, client events, seminars, webinars, and their own commercial initiative. The bonus structure reflects the ambition of the role rewarded strongly on new business and existing revenue, with significant earning potential for the right person. The role: • Building and managing a professional introducer network (solicitors, accountants, corporate advisers) generating a consistent pipeline of new HNW client opportunities, • Working closely with the Investment Management team to convert internal referrals and collaborate on joint client relationships, • Organising and hosting networking events, seminars, and webinars to raise profile and generate leads across the South West, • Growing introductions and referrals from your existing client base by delivering exceptional outcomes and asking for advocacy at the right moments, • Owning your new business plan, pipeline, and growth targets, with the support of a well-resourced distribution strategy behind you, • Delivering high-quality, compliant financial planning advice across the full range of client needs What we're looking for: • An experienced Financial Planner with a genuine hunger for business development and a track record of growing client books, • Well-connected in the professional introducer community - someone with existing relationships or the credibility and drive to build them quickly, • Level 4 qualified as a minimum. Chartered or advanced qualifications would be a real advantage, • Strong technical knowledge and the ability to deliver high-quality, compliant advice to HNW private clients, • Commercially minded, self-motivated, and comfortable managing your own activity and pipeline What's on offer: • Basic salary of up to £100,000 depending on experience (potentially could go higher for the right person), • Significant performance bonuses rewarded heavily on new business generation but also will recieve bonus on existing revenue, • Full corporate benefits including pension, life assurance, income protection, and private medical insurance, • Flexible hybrid working with 1–2 days in the office per week, • The backing of a high-quality, well-resourced wealth management business with real scale behind it The South West is a fantastic market for growing a high-quality financial planning book, the opportunity here is real, and so is the earning potential for someone prepared to go and get it. If this sounds like the role you've been looking for and you would like to find out more, please apply or get in touch for further information. Nigel James Associates Connecting talent. Building success.

Skyray is a European Owners engineer and technical adviser organisation specializing in the design, engineering and construction of large-scale photovoltaic and energy storage projects. A subsidiary of the Everoze Group, we are based in Lyon, Milan, Lisbon, and Bristol. We support our clients on photovoltaic and BESS projects, from design to commissioning. Our mission: to accelerate the energy transition through innovation, rigor, and passion. About the role We are looking for an Office Manager to strengthen our operations in the United Kingdom. The purpose of this role is to manage daily administrative activities, support local team, and facilitate coordination with our European offices. You will play a key role in streamlining administrative processes, reducing processing times, and facilitating teamwork. This is a newly created position. Key responsibilities UK Administration • Processing supplier invoices, • Preparing monthly payroll inputs, • Following up on outstanding customer payments, • Managing the UK office HR Support • Preparing onboarding documentation for new employees, • Monitoring training administration, • Managing expense claims and employee travel Administrative coordination • Filing and archiving documents (invoices, contracts, reports, etc.), • Updating shared document repositories (SharePoint, Teams, etc.), • Checking the completeness and compliance of administrative files, • Supporting the automation of recurring reports, • Being a relay for corporate alignment of processes, policies and reports. Operational support • Acting as an administrative contact point for internal teams, • Supporting the organisation of internal events when required Profile Education: qualification in administrative assistance, business support, or a related field. Experience : • Minimum of 5 years of experience in an administrative or office support role, • Experience in an international environment would be an advantage Skills • Experienced user of MS365, Excel and office tools, • Familiarity with collaborative platforms (Teams, SharePoint, etc.), • Basic knowledge of UK employment regulations would be beneficial, • Strong organisational skills and attention to detail, • Good written and verbal communication skills Personal qualities • Able to work independently and prioritise tasks, • Proactive and self-motivated, • Comfortable working in an international environment, • Interest in digital tools and process improvement General Information • Position: Office manager / Administrative assistant, • Location: Bristol (partial remote working possible), • Contract: Permanent, • Start date: As soon as possible, • Minimum of 5 years of experience in an administrative or office support role, • Languages: English is essential. French, Portuguese or Italian preferred Why join us? • An international and dynamic working environment, • A key role in supporting operational efficiency, • Autonomy in organising your work, • Hybrid working model How to Apply ? Submit your CV and Cover Letter to :

In House Legal Counsel - Corporate/Commercial Our client is a global leader operating within the industrial and manufacturing sector. As part of an established in house legal function, you will provide a wide variety of commercial legal advice within a dynamic and complex business environment. We are looking for a versatile Commercial/Corporate lawyer with a commercial approach. This is an ideal opportunity for a Corporate lawyer to move into a broader role In House and into a role incorporating Corporate and commercial work. Key responsibilities • Act as a key contact for stakeholders in a range of business units and corporate support departments to help influence and implement business strategy and direction., • Act as a primary contact for the UK sales subsidiary providing day‑to‑day advice to sales and marketing colleagues., • Review, draft and negotiate high-value, complex commercial contracts with customers, sales intermediaries, suppliers, service providers and other key business partners., • Corporate Support/Assist with M&A, • Support the business with responses to tenders and customer queries., • Support on L&S change and process improvement projects that underpin the business’s key objectives across multiple disciplines., • Support operational and commercial functions with day-to-day legal queries and issues., • Work with product development teams to ensure compliance with commercial and IP frameworks., • Assist in maintaining the L&S team’s templates, precedents and other know-how materials., • Provide practical solutions to complex legal problems as a key business partner., • Support senior lawyers as required, both in the UK and internationally. Key requirements • Qualified solicitor (UK) with 1+pqe and experience in delivering pragmatic, commercial legal advice in a demanding private practice or in-house environment., • Corporate specialism or training, • Excellent drafting commercial contracts experience, • Strong interpersonal and relationship building skills Desirable • Mergers and acquisitions, • Real estate and property, • Construction, • Software licensing and AI, • Contract management and other legal tools **This is a role requiring office presence 3 days per week. The offices are easily commutable from Bristol.

55,000 - 65,000 per annum dependent on experience Risk Manager (Travel) Salary 55,000 to 65,000 per annum, dependent on experience Folkestone Hybrid Sagas Group Risk function exists to support the business in safeguarding our customers, our people, the company and its trusted reputation. We play a critical role in enabling sustainable growth by ensuring risks are well understood, appropriately managed, and aligned to our strategic ambitions. Our Travel Business spans Ocean and River Cruise, as well as Holidays including stays and touring, and as we continue to evolve and grow, we need to expand our second line Risk team. Reporting into the Head of Risk, youll partner closely with this dynamic and customer-focused part of the business. This is a highly visible and impactful role, offering the opportunity to influence decision-making at a senior level, shape risk practices within a complex and regulated environment, and contribute to delivering exceptional experiences for our customers. You will act as a key member of the Group Risk function, embedding a strong risk culture, providing independent challenge, and supporting the Travel business in taking informed, responsible risks in line with its appetite. This is an exciting opportunity for someone who combines strong technical risk expertise with a commercial mindset and a passion for the travel sector. This role requires you to be working from our Folkestone office a minimum of 3 times a week. We have designated office space for colleagues in our Travel business, allowing us to collaborate and share success as a function. There will also be ad hoc travel to our other sites in London, Crawley & Southampton. Role Responsibility As our Risk Manager you will act as a trusted risk business partner and advisor to the Travel business to support them in taking and managing risks responsibly to achieve their strategic objectives in line with their agreed risk appetite. Other accountabilities will include: Working with our Travel Business to ensure that colleagues across all leadership levels understand how we manage risks at Saga, and what is expected of them in respect of risk management. Supporting the annual refresh of the Risk Strategy and plan, and delivery of this for Saga Travel. Using your knowledge of the travel industry to support the business to regularly review their Risk and Control Self Assessments (RCSAs) and ensure internal control testing is undertaken effectively by the business. Oversee the quality of control testing, providing challenge and guidance where appropriate. Supporting the Travel Executive team to oversee and report on the effectiveness of their material controls under the requirements of Provision 29 of the UK Corporate Governance Code. Facilitating the cascade of Group risk appetite statements within Travel, ensuring they are tailored appropriately to enable the achievement of Travels strategic objectives. Monitor the management of risk within the appetites through reporting. Oversight of Travel incidents, providing an independent check and challenge to ensure the root cause is understood and appropriate actions are in place to prevent recurrence. Supporting development and maintenance of risk management policies, procedures, and guidelines to our expectations are clear for Travel, and consistent with the Group. Supporting managements understanding of the risk management system through facilitating training, informal discussion, online tools, policies and guidance documents. Preparing and presenting clear, concise risk reports and opinions to senior management and relevant stakeholders, highlighting key risk exposures, trends and mitigation activities. Ensuring risk reports ultimately provide value to management. Attending and participation in Exec risk committees and other governance fora where risk engagement is required. Providing robust challenge and insights on key projects, key risk exposures, emerging risk, trends, control effectiveness, lessons learnt on material incidents. Supporting the development and delivery of the 2nd Line assurance plan, completing your own risk-based assurance over Travels control environment. Providing appropriately pragmatic and commercial recommendations to manage and mitigate risk. The Ideal Candidate As our Risk Manager for the Travel business, you will bring a strong understanding of both the travel industry and risk management frameworks. Youll be confident in identifying, assessing and documenting risks and controls, undertaking control testing, and delivering clear, insightful risk reporting that supports effective decision-making. Whilst direct experience of risk management is desired, we welcome candidates with significant travel sector experience who can demonstrate strong stakeholder management and business partnering capability, building trusted relationships at all levels. If you have strong influencing, interpersonal and communication skills, and are less experienced in risk we have the capacity to upskill your risk management expertise. Other experience required: Lead International Safety Management (ISM) auditor qualification, or experience working towards this, is desirable, or Strong understanding of maritime regulation and knowledge of Package Travel Regulations (PTRs) is desirable. Qualified risk professional, or equivalent practical experience in a risk management role. Experience of third-party risk management and oversight. Knowledge of risk, compliance and quality assurance within travel or similarly regulated industries. Proven track record of working effectively with senior stakeholders on risk and control frameworks. Ability to operate successfully in a complex, matrixed organisation, balancing multiple priorities. Strong influencing skills, with the confidence to provide independent challenge where required. Excellent interpersonal and communication skills, with the ability to translate risk into meaningful business insight. Sound judgement, with the ability to exercise discretion and make decisions on matters of significance. Saga Values: Make it Happen, Do the Right Thing, Customer First, Excellence Every Day, Our People Make Us Special Package Description At Saga we recognise that our people make us special. We believe our colleagues deserve rewards for the excellence they demonstrate every single day, that's why we have put together an amazing benefits package for all colleagues. BENEFITS AVAILABLE FOR THIS ROLE: • 25 days holiday + bank holidays, • Option to purchase additional leave - 5 extra days, • Pension scheme matched up to 10%, • Company performance related annual bonus - Up to 5%, • Life assurance policy on joining us, 4 x salary, • Wellbeing programme, • Colleague discounts including family discounts on cruises, holidays and insurance, • Range of reductions and offers from leading retailers, travel groups and entertainment companies, • Enhanced maternity and paternity leave, • Grandparents leave, • Income protection, • Access to Saga Academy, our bespoke learning platform About the Company Over the past 70 years we have become the UK's specialist provider of products and services to people aged over 50 in the UK. The Saga brand has become one of the most recognised and trusted brands amongst UK consumers in this demographic, recognised for its high quality products and exceptional standards of service. These include cruises and holidays, insurance, personal finance and the Saga Magazine.At Saga we are committed to treating all employees fairly and to offering equal opportunities in all aspects of employment and advancement. We value diversity not just because it is the right thing to do, but because diverse teams perform better.Fair consideration is given to applications from all applicants, including those with disabilities and those over who are over 50 as we are champions of age inclusivity. We are an official Disability Confident Committed employer and ensure that our recruitment process is inclusive and accessible and we will make reasonable adjustments as required. For more information on our DEI policies please visit our Saga Careers page.Saga does not accept agency CVs unless specifically engaged on the role by the Talent Acquisition Team. Please do not forward CVs to our recruiters, employees or any other company location. Saga will not be responsible for any fees related to CVs received in this unsolicited manner.Job Reference: saga/TP/56250/3461

About Headford Capital Headford Capital is a boutique corporate finance advisory firm based in Aztec West, Bristol. We support owner-managed businesses and SMEs across the South West and UK on mergers, acquisitions, disposals, and capital raises, typically in the £5M£50M range. Were deal-driven, sector-agnostic, and hands-on. You wont be stuck in pitch decks youll run live transactions and work directly with business owners from day one. Role Purpose The Managing M&A Advisor leads both deal execution and origination. Youll manage a portfolio of mandates, run client relationships, and guide junior analysts. This is a client-facing, office-based role requiring strong commercial judgement, technical capability, and the ability to close. Key ResponsibilitiesDeal Execution * Lead end-to-end M&A processes: IM creation, buyer targeting, management presentations, data room, negotiation, SPA completion * Oversee financial modelling, valuation, and commercial analysis * Coordinate due diligence with legal, accounting, and specialist advisors * Drive deals to co...

Senior Systems Support Engineer About the Company Our client is a global technology organisation delivering innovative solutions across transportation and critical infrastructure sectors. The company focuses on improving customer experiences through advanced technology, operational excellence, and secure digital services. Operating internationally, they are committed to innovation, collaboration, and delivering high-quality solutions to both public and private sector customers. The Role We are seeking a Senior Systems Support Engineer to support the operational delivery and maintenance of enterprise endpoint management and patching solutions across a large-scale corporate IT environment. The successful candidate will be responsible for maintaining endpoint management platforms, delivering software deployments, managing operating system builds, supporting security patching activities, and providing 2nd/3rd line technical support. The role also involves root cause analysis, technical project delivery, and ensuring compliance across end-user environments. Key Responsibilities • Ensure the availability and performance of endpoint management and software deployment platforms., • Manage and maintain services including:, • Patch Management, • OS Provisioning, • Software Distribution, • Endpoint Configuration, • Develop and maintain operational processes relating to system builds, patch creation, software packaging, deployments, reporting, and security controls., • Investigate and remediate security vulnerabilities across desktop and server estates within agreed timelines., • Support security hardening and compliance activities across front-office platforms and applications., • Assist in improving endpoint delivery strategies including:, • Application deployment, • Antivirus management, • Security patching, • Driver and firmware updates, • Operating system deployment, • Manage documentation relating to systems, processes, and operational procedures., • Own the full lifecycle of patch deployment activities from testing through to production rollout., • Support platform upgrades, migrations, and access control management., • Participate in technical projects involving software deployment to bespoke hardware and devices., • Escalate issues appropriately and contribute to incident resolution., • Support training and knowledge transfer activities following technical changes., • Work collaboratively with internal teams, stakeholders, and customers where required. Required Skills & Experience Essential • Degree in Computer Science, Engineering, or equivalent commercial experience., • Strong experience with enterprise patch management and endpoint management tools such as:, • Ivanti Endpoint Manager, • Microsoft SCCM, • ManageEngine, • NinjaOne, • or similar technologies, • Strong PowerShell scripting experience., • Experience deploying and supporting Microsoft operating systems across desktop and server environments., • Experience supporting multi-platform infrastructure environments., • Proven experience managing patch testing and deployment environments., • Strong understanding of Microsoft Windows desktop support., • Experience supporting Linux/Unix desktop environments (e.g. Ubuntu)., • Experience working within ITIL environments including change and release management., • Understanding of quality and service management standards such as ISO 9001 / ISO 20000., • Strong networking fundamentals including TCP/IP., • Experience with Microsoft Active Directory technologies including:, • DNS, • DHCP, • Group Policy, • WSUS, • DFS, • Experience with OS imaging and deployment technologies including PXE and system imaging solutions. Desirable • ITIL certification., • Microsoft certifications., • Experience managing services against strict SLAs., • Experience with virtualisation technologies including:, • VMware, • Hyper-V, • Experience with additional scripting or development languages such as:, • Bash, • Powershell, • VB.NET, • C++, • .NET, • Batch scripting

GP/Health Screener Town: Northampton, Milton Keynes Part Time: 5 sessions / 2.5 days / 20 hours per week Permanent: Salaried Shift times: Only open Monday to Friday - office hours Salary: £10,400 per session + exceptional benefits We're looking for a talented GP to join our client looking after corporate patients in Northampton and Milton Keynes. The client is the UK's largest private patient GP employer and this is a really exciting opportunity to work with them in the Midlands. The majority of the sessions would be carrying out health screenings in Northampton, with 2 days per month in Milton Keynes. One session per week would be remote GP Telemedicine work from home, and there is scope for this to be on a Saturday or Sunday if preferred. The majority of the patients come through to them from their corporate clients; professionals who are prioritising their health and who value a comprehensive, personalised approach. If you have a passion for "prevention rather than cure" and lifestyle medicine, this could be the role for you! As a General Practitioner / Health Screener you'll provide Comprehensive primary care for an adult population who actively invest in their health; engaging with patients, exploring their medical history, addressing concerns and performing examinations. You'll also arrange investigations, provide guidance, prescribe, discuss medical options, treatments, and deliver expert advice. With advanced health screenings, you will have time to have those important lifestyle and coaching conversations and use extended appointment times to explore patients’ goals, support behaviour change, and develop actionable health plans. You will be expected to perform procedures such as taking bloods, smear tests and ECG's. You’ll have the time to care, the tools to succeed, and the flexibility to enjoy life outside of work with structured pre-booked appointments in office hours. GP appointments are 15 minutes and health screens range from 30 minute up to 2 hours depending on the type of screening being undertaken. What you'll bring: • GMC registered, • Strong communication and IT skills., • A proactive, patient-first approach with a genuine interest in preventative and lifestyle medicine coaching., • Training provided on 'Advanced' Health Screening., • Private Patient experience, desirable, but not essential.

Shape Your Career with TMC – Emergency Radiologist Opportunity | Relocation Opportunity to Australia, New Zealand or Japan. Join Europe’s leading tele-radiology network and redefine your work-life balance while delivering world-class diagnostics from Australia. At Telemedicine Clinic (TMC), a Unilabs company, they empower radiologists to thrive professionally while enjoying unmatched flexibility and support. To expand their team, we are searching for emergency radiologists eligible to work in Sweden, Denmark, or United Kingdom to relocate to Australia, for a minimum of 12 to 24 months. Japan for 3 or 6 months, or New Zealand for a minimum 12 months. The TMC emergency radiologist will be part of the Emergency section. This section aims to deliver high-quality radiological diagnostic services to our healthcare clients and the patients in a timespan of a maximum 1 hour, or less in case of stroke cases. Why Join Us? • The opportunity to work from Australia, Japan or New Zealand., • Competitive pay with attractive additional income, • Become a sub-specialist in Emergency Radiology, • Access cutting-edge AI tools and our proprietary RIS for efficient reporting (TMC is one of the leading adopters of AI in Europe), • Join a supportive international community of expert radiologists, • 24/7 IT support and a full home workstation provided, if not reporting from the office, • Free access to TMC-Unilabs Academy for CME-accredited training and fellowships (over 250 hours of free education), • Opportunities for leadership, teaching, and research roles, • Strong clinical governance and quality assurance through internal/external audits, • Visas paid for and done by TMC, as well as relocation costs covered What We’re Looking For • Medical doctor with a specialist degree in diagnostic radiology, • Minimum 1 year as a Consultant Radiologist, • Registration with Swedish, Danish, Norwegian or UK medical authorities (or eligibility to obtain it), • Ability to report in the language of at least one of those countries, • Proficiency in English (our corporate language), • Comfortable with digital tools and reporting systems, • Proactive, organised, and solution-oriented mindset, • Strong communication skills

You'll be a senior developer on our in-house travel management platform, working across the full stack — from React frontends to Node.js APIs and background processing services that handle live travel data. The platform spans Linux and Windows environments, including containerised services running on Docker. The role involves real-time problem diagnosis, complex data transformation across multiple databases, and a high degree of autonomy. You'll be expected to own technical decisions, independently investigate and resolve issues across the entire stack, and operate as a trusted point of escalation when things go wrong. This is a hands-on technical role with genuine responsibility. About Us: CTM is an award-winning provider of innovative and cost-effective travel management solutions to the corporate market. Our proven business strategy combines personalized service excellence with client-facing technology solutions to deliver a return on investment to our customers. Headquartered in Australia, we provide local services solutions to clients across the globe. Skills & Experience : • 3+ years commercial experience with Node.js and TypeScript, • Strong SQL skills — complex queries, relational schemas, multi-database environments (PostgreSQL and/or MS SQL Server), • React (hooks, functional components), • Experience transforming and mapping complex data structures (XML, JSON), • Git — confident with branching, conflict resolution, • Familiarity with NestJS, tRPC, or similar API frameworks is a strong plus, • Experience with background processing patterns (queues, cron jobs, webhooks) is highly valued Key Responsibilities: • Build and maintain features across React frontends and Node.js/NestJS APIs, • Develop and support background processing services that ingest and transform travel data from external systems, • Write and optimise complex SQL across PostgreSQL and MS SQL Server databases, • Investigate and resolve production issues end-to-end — from browser through API to database and background processors, • Drive forward platform modernisation initiatives as they are prioritised Please note that this role requires a security clearance process (you must have lived in the UK for 5 consecutive years to be eligible) and a DBS check. Do not apply if you are not willing to undergo these conditional background checks, this continually applies during the course of your employment. You can read about SC on the government site - ___ Join our crew and help CTM take flight. Apply now and pack your skills for a business travel journey that promises growth, discovery and plenty of first-class moments. What to expect from the recruitment process : • Every hire starts with a chat with our Talent Acquisition team, if your profile is selected you will be contacted by phone or email (please check your spam folder);, • Then, if you are progressing, the hiring manager will invite you to an interview, usually on Teams;, • If you are successful we will invite you to our office for a final stage interview. Wherever possible we will provide you with feedback, however we are a small team and often we won't be able to do so until after we fill the vacancy. CTM is a responsible employer and is dedicated to conduct thorough right to work checks in the interests of both parties, candidates and the company. Candidates selected and invited to an interview will be invited to a mandatory 15 min call with the TA lead to produce their RTW documents. This call is a mandatory step for all candidates regardless of their RTW status. This call is confidential and conducted by HR professionals only. CTM is an equal opportunity employer. We want to make sure our entire recruitment process is accessible to everyone. If you need accommodations at any stage of the application or interview process, please let us know: as a Disability Confident Employer, we’re here to support you in any way we can. Do not hesitate to connect with our Recruitment team if you need to discuss arrangements. Reward & Recognition Our learning platform CTM Learning, our annual conference the All Stars, our High-Performance programme and a global leadership programme. Employee Wellbeing and Flexibility Our wellbeing platform Vitality, our Employee Assistance Programme (EAP), our new private healthcare Medicash + our mental health first aiders. Most of our roles offer a hybrid working pattern, with 3 days per week in the office. Where permitted and depending on the role, we can offer flexible start and finish times to suit your other commitments and support a healthy work-life balance. We are committed to finding a setup that works for you and the business. Sustainability Focus Principles of Governance, People, Planet, and Prosperity, CTM’s Sustainability Strategy identifies material issues and outlines initiatives to achieve this. CTM is the Data Controller with respect to the personal information you provide during your application. We will use this information solely to process your application, and our legal basis is that you are considering taking up an employment contract with us. We may share this information with our parent company in Australia, but otherwise we will not disclose it to any other organisation. If you take up employment with us, we will keep the information for the duration of your employment, otherwise we will destroy it 2 months after the post is filled. All the information that we ask for in application forms has to be completed for your application to go ahead. There is no profiling or automated decision making applied to the personal information you supply. You have all the legal rights with your personal data as laid out in the General Data Processing Regulation (GDPR) and the Data Protection Act 2018, including the right to complain to the Information Commissioner’s Office. Our Data Protection Officer may be contacted at

* * SALARY:Starting from 58,732.80 pa dependent on experience LOCATION: Milton Keynes HYBRID WORKING: Our current hybrid working policy requires a minimum of 60% of working time to be based in the Milton Keynes office however flexibility is expected to meet the needs of the business and the role. HOURS / CONTRACT TYPE: Full Time Permanent, 35 hours per week CLOSING DATE: 27/05/2026 We reserve the right to close the advert earlier If we receive a high volume of applications. Shape the future of leasing at VWFS This is a pivotal commercial role at the heart of our Retail Leasing growth. As Leasing Partnerships Manager, youll lead the development of strategic relationships across Volkswagen Group brands, securing vehicle supply and shaping how we deliver a consistent, competitive leasing proposition across all sales channels. Youll operate at the intersection of brand, product and sales - bringing alignment, driving performance, and influencing how we grow in an increasingly complex and competitive market. Why this role matters: Youll play a key role in delivering VWFS UKs leasing growth ambitions Youll shape how we collaborate with Volkswagen Group to unlock commercial opportunity Youll influence strategy across Retail, Broker and Corporate sales channels Youll operate in a high-visibility role with exposure to senior stakeholders across VWFS and VWG What youll be doing: Build and influence senior relationships across Volkswagen Group brands to secure CtP (commit to purchase) vehicle supply Lead commercial negotiations to deliver competitive pricing and maximise channel performance Align leasing campaigns across RCH (Retailer introduced Contract Hire), CtP and CTM (commit to market) to drive impact while protecting channel integrity Partner with Broker and Retail teams to unlock growth and ensure clear channel differentiation Use market insight and data to inform decision-making and future strategy, Influencing governance forums and brand reviews, shaping Contract Hire planning and direction Drive engagement and performance across retailer networks supplying CtP vehicles Oversee end-to-end operational delivery, from vehicle logistics through to customer outcomes Provide leadership continuity, stepping in for senior leaders where required What youll bring: Youll be a commercially driven team player who thrives in a fast-paced, target-led environment and is confident operating at a senior level. Youll combine strategic thinking with a strong bias for deliveryable to build relationships, influence outcomes, and turn opportunity into tangible business results. Essential experience & skills: Proven success in sales or commercial roles, with clear delivery of growth outcomes Strong background in automotive financial services or vehicle leasing Strong commercial acumen and understanding of automotive and financial markets Experience influencing senior stakeholders across complex, matrix environments Deep understanding of leasing products, distribution channels and customer journeys Skilled negotiator with the ability to operate at senior level Ability to translate data and insight into actionable commercial decisions Strong communication and presentation skills, including Board-level materials What makes this opportunity stand out High-impact role within a key VWFS growth area Opportunity to shape a strategically important channel Broad exposure across VWFS, VW Group brands and multiple sales functions A role combining strategy, commercial negotiation and operational delivery Whats in it for you? Bonus: Discretionary 10% on-target bonus (based on personal and Group company performance) Pension: Employer pension contribution of 9% (based on employee contribution of 3%). VWFS will pay 6% if employee chooses a 2% employee contribution. Car schemes*: Choice of Employee Car Ownership (ECO) scheme for petrol/diesel and hybrid vehicles plus car insurance. OR Company Car scheme for Battery Electric Vehicles (BEVs) plus car insurance cover for you and a partner/eligible family member. Other benefits: From day 1 we provide income protection, life assurance (4x salary), retail discount vouchers , access to Care Concierge (a service to support carers of adults), along with other salary sacrifice options including a will writing service and cycle to work (subject to scheme restrictions). Following successful completion of probation, you will have access to private medical insurance for you (with the option to buy additional family cover), access to our loan car scheme for up to 2 cars for your partner or eligible family members (subject to scheme restrictions) and during our annual benefit window you can purchase critical illness cover and dental cover , so you can select the benefits that matter to you. We invest in our people and are passionate about driving development. Youll have access to LinkedIn Learning via our Degreed platform as well as a host of professional development programmes and opportunities to build your technical and soft skills so you can further develop your career. We also offer mentoring schemes and reciprocal partnerships recognising that we can all learn from each other in the flow of work. * * * Why join VWFS UK? Youll have the opportunity to make a difference by helping us to achieve our mission. Our mission is straight forward; we want to be 'The Key to Mobility'. That means we make getting from A-to-B as easy and simple for as many people as possible. To truly meet the mobility needs of people in a changing world, our offering goes beyond traditional vehicle financing. We do this by providing a range of finance and aftersales products on Volkswagen Group vehicles, as well as developing innovative mobility products designed to solve real problems and support our customers. No candidate will meet every single desired qualification. If your experience looks a little different from what we've identified and you think you can bring value to the role, we'd love to learn more about you! VWFS is proud to be an inclusive employer and encourages applications from a diverse range of candidates. Diversity, Equity & Inclusion isnt just a statement for us, we encourage and aspire for all our colleagues to be their 100% self. If you need any reasonable adjustments to assist you with the application and/or recruitment processes, please contact our Resourcing Team. This role does not meet the UKVIs criteria for the skilled worker sponsorship route, therefore we are unable to accept candidates requiring sponsorship for this role. Apply now If youre ready tolead a critical area of our leasing business and drive meaningful commercialgrowth, wed love to hear from you.

The Most Lucrative Recruitment Desk in the UK Legal Market Realistic £100,000+ OTE within 18 Months This is not a standard recruitment role. This is an opportunity to help spearhead and grow one of the most lucrative legal recruitment desks in the country, operating at the heart of the City of London legal market. This set up offers the ability to earn top City of London earnings, whilst enjoying the benefits of being based in Bristol. The London legal market is one of the highest-value recruitment sectors globally. To put this into perspective: • Newly Qualified Solicitors at top US law firms can earn up to £170,000+ (£37k fee for junior lawyer placement), • Individual recruitment fees can range from £35,000 for junior placements to £60,000–£100,000+ for senior hires, • The market is driven by elite UK and US law firms competing aggressively for talent For the right recruiter, the earning potential is enormous. About JMC Legal Recruitment JMC Legal Recruitment is one of the UK’s leading specialist legal recruitment firms. We have built an exceptionally strong reputation within the London legal market and are recognised nationally as one of the industry’s leading brands. Our achievements include: • More 5-star Google reviews than any UK-based legal recruiter, • Number 1 Google rankings across 90+ legal recruitment search terms, • Long-standing relationships with leading UK, US, and international law firms, • Regular commentary within industry and national press on topics such as talent retention, lawyer movement, and law firm growth strategy We are often the first point of contact for firms seeking strategic hiring advice and market insight. This role offers the opportunity to join a business that already has genuine market credibility and visibility. Culture & Environment We have built JMC Legal Recruitment around the belief that high performance and positive culture should go hand in hand. Our environment is ambitious, hard-working, and commercially driven - but without the overly corporate, KPI-heavy atmosphere often associated with recruitment. We operate with an adult, professional culture built around trust, accountability, and autonomy. What that means in practice: • Hybrid working, • Flexible, grown-up working environment, • Dress-down culture from day one, • Strong emphasis on collaboration rather than internal competition, • A business that genuinely invests in technology, innovation, and AI to stay ahead of the market, • Access to industry-leading recruitment tools and systems We are also proud of the culture we have created internally. Despite operating within a high-performance industry, the business has retained a genuinely supportive and close-knit feel throughout the team. Many of our staff have been with us for years, and we are proud of our strong staff retention across the company. Alongside the work itself, we regularly organise: • Side on Side training with our Managing Director, • Everyone has weekly mentoring with our CEO who spearheads our learning and development function, • Monthly team socials, • Team lunches and events, • Incentives and celebrations, • A collaborative office environment where people enjoy coming to work We believe recruitment works best when talented people are given: • The right support, • The right training, • The right tools, • And the freedom to grow into their potential without being micromanaged For the right person, this is an opportunity to join a business that combines serious market opportunity with a genuinely enjoyable working environment. The Opportunity We are now looking to appoint a Recruitment Consultant to help build and spearhead our City of London legal division. This is a rare opportunity for someone ambitious to: • Operate within one of the highest-fee recruitment markets globally, • Work directly with elite UK and US law firms, • Learn partner and senior-level recruitment strategy, • Build long-term relationships with high-performing legal professionals, • Eventually grow and lead a team within the division This desk has the potential to become a multi-million-pound division within the business. You will work directly alongside: • Jason Connolly, CEO of JMC Legal Recruitment, who has a personal billing track record in excess of £1million per annum, • Sean Nicholson, Managing Director and Head of London, one of the most experienced legal recruiters in the market You will also be surrounded by consultants with 7+ years legal recruitment experience and exceptional billing track records. This is a genuine learning environment where you will be developed properly. What We Are Looking For This role requires confidence, intelligence, communication skills, and ambition. You will be speaking daily with highly intelligent and commercially sophisticated professionals, often operating at senior levels within major law firms. We are therefore looking for someone who: • Has at least 12 months’ experience within recruitment, sales or business development OR you may have worked within the legal sector, • Is highly confident communicating with people, • Is commercially minded and financially motivated, • Learns quickly and can absorb information on the job, • Has strong emotional intelligence, • Has natural negotiation and influencing skills, • Wants to build a long-term, high-income career What You Will Receive • Competitive basic salary, • Uncapped commission structure, • Genuine six-figure earning potential, • Direct mentorship from highly successful recruiters, • Clear progression pathway, • Hybrid working, • High-performance but supportive culture, • Opportunity to help build and shape a major division Why This Role Stands Out Most recruitment roles ask you to build something from nothing. This role offers the opportunity to build within an already established, market-leading platform with significant reputation, visibility, and momentum. For the right individual, this could become a career-defining opportunity. Apply If you are ambitious, driven, commercially minded, and want to build a career within one of the most lucrative recruitment markets in the world, we would welcome a confidential conversation.

About the Role Ready to shape radiological safety standards that protect people, plants, and performance across the nuclear fleet? Do you want your expertise to influence decisions at the highest level and deliver consistent best practice where it matters most? At EDF, Success is Personal, and this role gives you a clear opportunity to see the impact of your expertise. As Radiological Protection Fleet Manager, youll play a critical role in supporting EDFs journey towards An Electric Britain , ensuring fleetwide excellence in radiological protection and dangerous goods transport. Youll own policies, standards, and performance frameworks, working closely with senior leaders, regulators, and station teams to embed industryleading practice across generation. This role is ideally based from #GloucesterBusinessPark, with flexibility to be near another office across the fleet. Youll work a hybrid pattern, spending 23 days per week in a local office, with regular travel to nuclear sites to support delivery and continuous improvement. What Youll Be Doing • Owning fleet radiological protection and dangerous goods transport policies aligned with regulatory and industry best practice, • Managing the corporate team of Radiation Protection Advisers and Dangerous Goods Safety Advisers, • Driving standardisation, performance monitoring, and continuous improvement across all nuclear stations, • Leading peer groups, setting KPIs, and reporting fleet performance to senior governance forums, • Developing and delivering fleet improvement plans, including budget and investment oversight Were looking for a Radiological Protection Fleet Manager who leads with authority, clarity, and integrity, and who thrives in a highly regulated nuclear environment. Do you offer deep operational expertise and the confidence to influence at fleet and executive level? • A current Radiation Protection Adviser (RPA) Certificate of Competence would be an advantage, • A degree or HND in a relevant topic maybe an advantage, • Significant experience in operational radiological protection, ideally within a nuclear power station environment, • Experience leading teams, peer groups, or governance programmes within a nuclear operator environment, • Strong knowledge of UK legislation, Site Licence Conditions, and radiological protection standards Pay, Benefits and Culture Alongside a competitive starting salary, potential for an annual bonus, and a marketleading pension scheme, your package will include customisable benefits such as electric vehicle leasing, discounted gym membership, life assurance, tech vouchers, experience days, and more. Everyone is welcome at EDF; were committed to building a workforce that reflects gender balance, social mobility, and inclusion of minority ethnic backgrounds, LGBTQ+ communities, and those with disabilities. As a Disability Confident employer, we will support applicants requiring adjustments. Join us and find your success at EDF! Our Values: What You Can Expect When You Join Us As you consider joining EDF Nuclear Operations, we want you to know what drives us. Our values are more than words, they shape how we work, how we grow, and how we support one another. We move with agility, embracing change and responding quickly to new challenges and opportunities. This mindset keeps us innovative, adaptable, and ready to lead with proactive change. We pursue excellence in everything we do. Whether it's delivering highquality outcomes, collaborating across teams, or investing in personal development, we are committed to doing our best and helping others do the same. We act with integrity, always choosing to do whats right. Trust, respect, and transparency are the foundation of our culture, and we hold ourselves accountable to the highest ethical standards. These values are not just what we believe, theyre how we work. If they resonate with you, youll thrive here. Closing date for applications is 24th May, interviews will follow shortly after. #SuccessIsPersonal #EDFcareers #LI-Hybrid #DestinationNuclear Success is Personal. It's your journey, powered by us. Join us and drive the transitiontowards An ElectricBritain.

85,000 to 110,000 (DOE) Senior Assistant Company Secretary Salary 85,000 to 110,000 depending on experience Permanent Hybrid Home & Folkestone / London Here at Saga, we have rare opportunity for a Senior Assistant Company Secretary. Youll be joining a high functioning Company Secretarial Team. Working as a Senior Assistant Company Secretary, you will support the Company Secretarial Team professionally and administratively, dealing with all levels across a diversified Group. Its truly an exciting and varied role, you will act as named Company Secretary for the Insurance and Saga Money business units, and act as secretary to the plc Audit and Risk Committee, ensuring that all matters relating to internal controls and risk throughout the Group are reported and escalated, as necessary. This is a pivotal role in Saga, you will hold responsibility for the regulated entities while also assisting our Group Company Secretary on other Group related matters and projects across our exciting and varied organisation. We need you to be credible and knowledgeable with supporting at c-suite level within heavily regulated environments. You will be able to commit to working collaboratively as a team, deliver high quality work and have a pragmatic and commercial approach. Working closely with the Board, you can certainly have a positive impact to the overall strategy at Saga. We work in a hybrid way at Saga both at home and in the office. Our main locations for this role would be Folkestone, Kent and Kings Cross, London. Role Responsibility As the appointed Company Secretary to our Insurance and Financial Services FCA regulated entities within the Saga Group. (Saga Insurance and Saga Money.) Your key areas of responsibilities will cover; Maintaining an effective working relationship with the Insurance and Personal finance entity Chairs and CEOs to ensure that governance supports delivery of the strategy. Drafting and controlling annual corporate calendars. Preparing agendas, governance reports, collating and circulating papers, and drafting minutes for boards and committees where appropriate. Working collaboratively with business areas to ensure supporting board and committee papers and actions are high quality, providing a check and challenge to initial drafts and ensuring that executive summaries are used effectively. Attending and minuting Board, Remuneration/Nomination Committee and Audit, Risk and Compliance Committee meetings (Insurance) and plc Audit and Risk Committee. Maintaining and updating governance documents, including Terms of Reference, delegated authority matrices, and division of responsibilities. Ensuring that the flow of reporting between subsidiaries and Saga plc is effective - with a focus on audit, risk and internal controls. Providing advice on current best corporate governance practice. Liaising with the Conduct Risk Team on regulatory matters (i.e. FCA) and ensuring that corporate governance processes and procedures adhere with regulatory rules and expectations. Carrying out Non-Executive and Executive Director inductions within insurance and Saga Money, and ongoing development/ evaluation. Group: Supporting during the AGM preparation and the production of the Annual Report and Accounts (with specific responsibility for the Audit and Risk Committee report). Assisting with project work, as required e.g. group strategic projects, due diligence requests, Group Policies, ad hoc requests. Acting as a trusted adviser to senior stakeholders, providing guidance on governance issues, statutory duties, and company policies. Drafting resolutions and associated documentation for all governance matters e.g. projects, transactions, change of name, director or secretary changes, etc. Statutory and Regulatory Compliance: Monitoring developments in company law, corporate governance, and regulatory requirements. Ensuring full compliance with statutory and regulatory obligations, including Disclosure Guidance and Transparency Rules, Market Abuse Regulation, Listing Rules, UK Corporate Governance Code and other relevant frameworks. Project and Change Support: Contributing to significant corporate projects such as mergers, acquisitions, restructures, and new business ventures. Obtaining approvals by relevant Group companies and ensuring Board directors understand their responsibilities and fulfil their duties. Carrying out due diligence and supporting transactional governance requirements, working closely with internal and external advisers. Working with cross-functional teams including Legal, Tax, Treasury, Legal and external advisers to deliver projects. The Ideal Candidate You will have previously line managed in a Company Secretary function and be keen to join an organisation that is on a journey of transition and growth. You will have already worked in a Plc and/or regulated business. You will also be able to demonstrate the following skills and capabilities; Ability to build and maintain strong relationships with directors, senior executive and control functions High-level organisational skills, with the highest standards of professionalism and integrity Excellent interpersonal and communication skills (written and verbal) plus minuting experience Attentive to detail with a pragmatic, commercial and collaborative approach Excellent project management skills ability to respond quickly to ad hoc queries and manage conflicting priorities Come from a legal background, ideally with a law or business degree CGI qualified Chartered Governance Qualifying Programme Good knowledge of UK Companies Act 2006, FCA Disclosure and Transparency Rules and other relevant legislation Excellent working knowledge in the use of the latest company secretarial software, including board portal and entity management software. Saga Values: Make it Happen, Do the Right Thing, Customer First, Excellence Every Day, Our People Make Us Special Package Description At Saga, we recognise that our people make us special. We believe our colleagues deserve rewards for the excellence they demonstrate every single day, that's why we have put together an amazing benefits package for all colleagues. BENEFITS AVAILABLE FOR THIS ROLE: • 25 days holiday + bank holidays, • Option to purchase additional leave - 5 extra days, • Pension scheme matched up to 10%, • Company performance related annual bonus - Up to 15%, • Car allowance 4,800 per annum, • Private medical insurance after 1 years service, • Life assurance policy on joining us, 4 x salary, • Wellbeing programme, • Colleague discounts including family discounts on cruises, holidays and insurance, • Range of reductions and offers from leading retailers, travel groups and entertainment companies, • Enhanced maternity and paternity leave, • Grandparents leave, • Income protection, • Access to Saga Academy, our bespoke learning platform About the Company Over the past 70 years we have become the UK's specialist provider of products and services to people aged over 50 in the UK. The Saga brand has become one of the most recognised and trusted brands amongst UK consumers in this demographic, recognised for its high quality products and exceptional standards of service. These include cruises and holidays, insurance, personal finance and the Saga Magazine.At Saga we are committed to treating all employees fairly and to offering equal opportunities in all aspects of employment and advancement. We value diversity not just because it is the right thing to do, but because diverse teams perform better.Fair consideration is given to applications from all applicants, including those with disabilities and those over who are over 50 as we are champions of age inclusivity. We are an official Disability Confident Committed employer and ensure that our recruitment process is inclusive and accessible and we will make reasonable adjustments as required. For more information on our DEI policies please visit our Saga Careers page.Saga does not accept agency CVs unless specifically engaged on the role by the Talent Acquisition Team. Please do not forward CVs to our recruiters, employees or any other company location. Saga will not be responsible for any fees related to CVs received in this unsolicited manner.Job Reference: saga/TP/ /3466

Step into a role which offers fantastic breadth of work and clients. A brilliant culture, Big 4 calibre clients within a supportive Mid Tier environment. A exciting opportunity to find your long term home as a Tax advisor. You will have high levels of access to Partners and clients from Day One and work on the type of clients you prefer, regardless of geography. You'll make an impact by: • Acting as an expert advisor, guiding clients with their tax affairs on the compliance side and supporting when planning matters arise, • Building and maintaining strong relationships with clients ranging from owner-managed businesses and middle market organisations to large multinational groups, • Playing an active role in business development, proposals and networking events and making a significant contribution to the overall future development and success of not only your regional office, but the wider firm, • Developing and supporting a growing team, being a mentor and sharing your skills and knowledge You must have a UK qualification, either ACA or CTA ideally and UK Corporate Tax compliance and/or advisory background. Robert Walters Operations Limited is an employment business and employment agency and welcomes applications from all candidates ...

Interviews will take place week commencing 15th June 2026 Full details of the role can be found in the attached Candidate Brief. As Chief Operating Officer (COO) you will be responsible for providing strategic leadership to Homes England’s enabling functions. You will embrace and role model the values and behaviours as a leader and colleague across the Agency more widely. Working closely with our Chief Executive Officer and the rest of the Corporate Leadership Team (CLT), your input will be critical to the success of the Agency’s mission and government’s housing priorities. As Chief Operating Officer you will provide leadership across people, digital, change, performance, estates, legal, commercial and business services, enabling effective decision making, organisational resilience and value for money, while supporting the Chief Executive and Board. About the role. As Chief Operating Officer you will provide strategic leadership of the Chief Operating Office, aligning individual expert contributions toward a shared vision, and leveraging diverse skills for collective problem-solving. Ensuring high quality, efficient and resilient enabling and corporate services that support delivery of Homes England’s mission. • You will be a core member of the CLT, contributing to corporate strategy, organisational performance, and long-term sustainability., • You will lead organisat...

A growing Corporate & International tax team is looking to appoint an experienced Assistant Manager or Manager to join its Bristol office. The team works with a broad range of clients across multiple sectors on diverse and complex projects, including corporate tax compliance and advisory work. W

We are Centrica! Were so much more than an energy company. Were a family of brands revolutionising a cleaner, greener future. Working here is #MoreThanACareer - were powered by purpose. Together we can make an impact that will truly change tomorrow. Whether youre developing cutting-edge green tech, helping customers on the front line or simplifying operations behind the scenes.Your work here isnt just a job its a mission. We all play a vital role in energising a greener, fairer future . We have a brilliant new opportunity for a Public Affairs Manager to join our team. Supporting our Head of Public Affairs (Power & Infrastructure) and wider public affairs team, you will help to strengthen Centrica's public profile, shape policy outcomes, and build trusted relationships with government and political stakeholders. In this role you will help to devise and deliver engagement campaigns which demonstrate Centrica's investment for long-term energy security and resilience and retain focus on sustainability goals. Location: The successful candidate would be employed initially at our company's offices in Windsor, but as the Windsor office is due to close later this year, you will be moved to the company's new offices in Reading and/or London. You will be required to work flexibly, including from home and at our office locations. Key Accountabilities: • Monitor political events and parliamentary business and update colleagues with timely and accurate briefings on relevant events., • Building and supporting Centrica's relationships with MPs, advisors and other political stakeholders, including mayoralty and local authority stakeholders, through a regular face-to-face engagement programme, as well as email and phone communications., • Support on local engagement programmes, including VIP visits to our sites and assets. This may include regular travel to locations which host Centrica operational assets., • Collaborating with Corporate Affairs colleagues to create compelling campaigns, content and messaging to highlight Centrica's contribution to energising a greener, fairer, future., • Assist with strategic briefings and intelligence for senior level colleagues on Government policy., • Represent the business, attend meetings on behalf of the public affairs team, including external visits to Parliament and to MP energy advice events (note this may involve some travel)., • Provide advice and guidance on external communications issues, while also identifying potential risks and opportunities, and pro-actively supporting Corporate Affairs strategy., • Experience within a political environment, either civil service, Parliament, an agency, or similar setting., • Demonstrable understanding of UK politics and parliament., • Demonstrable understanding and/or experience of the energy sector, including Power & Infrastructure is desirable.

Term Type:PermanentDepartment:Employment Birketts is a full service, UK Top 50 law firm. With a heritage spanning 160 years, we have more than 700 lawyers and legal professionals based in Bristol, Cambridge, Chelmsford, Ipswich, London, Norwich and Sevenoaks. We advise businesses, government and public sector organisations and individuals in the UK and internationally across four principal practice groups: Real Estate, Corporate Services, Dispute Resolution and Private Client. We are defined by our Next Level Law proposition. We work with our clients as a proactive partner, horizon scanning and thinking ahead to the changes, challenges or opportunities that they may face. Next Level Law is also applied to our people. Our collegiate culture means everyone is encouraged to achieve their next level in everything they do. RollOnFriday recently ranked us as the 5th best law firm to work at in 2024. With our ambition to succeed, comes a strong desire to make a positive contribution to the communities we serve, and we are committed to delivering the objectives set out in our ESG strategy. Diversity plays an integral part in all that we do, with female partners comprising 40% of our partnership. Our vibrant, energetic Employment Team boasts some of the best lawyers in the business specialising in all aspects of employment law facing a company's board or the HR professional - from everyday operational challenges through toadvising onstrategic issues. The team currently comprises over 30specialist qualified employment law solicitors, including nine partners working across six offices, making us one of the larger employment teams in the country. We have the strength and depth of expertise to ensure we deliver the service you would expect in respect of technical quality, practical approach, and timeliness of advice. Birketts employment law team has experience in all areas of contentious and non-contentious employment law matters, representing clients from a broad range of public and private organisations as well as individuals and senior executives and we are proud to act for sector leading clients nationwide and some important and high-profile businesses and institutions across a number of key sectors. Ranked 1 tier in Chambers and Legal 500, you will join a highly successful Employment team which is seeing consistent and continuous growth, and which works and collaborates closely as a supportive team of colleagues. Our employment advice is supplemented by a well-developed in-house employment client training offering, a HR consultancy service, a workplace investigations service, an employee incentives group, a team of accredited mediators and an immigration team. Our new, vibrant Bristol office is a fantastic opportunity for an established senior Employment law at Legal Director or Partner level to launch our offering in the South West and build upon the work between supporting locations. The ideal candidate will have strong existing connections and the ability and desire to build and develop a team. Current sectors in which we work include education, financial services, construction, transport and private client/agriculture, charities and public sector.Particular areas of expertise sought include: • General employment issues ranging from maternity rights to general contractual issues, • Drafting service agreements, contracts of employment and staff handbooks, • Drafting and reviewing employment policies ranging from performance, sickness, and misconduct procedures to maternity and parental leave schemes, • Transactional corporate support work, • Wrongful and unfair dismissal, • Redundancy and restructuring, • Transfer of Undertakings, • Awareness of boardroom disputes and severance claims, • Employment litigation in the employment tribunal, • Discrimination (including sex, race, disability and age), • Trade union work for employers and Professional Discipline and conduct, including advising professional conduct/fitness to practice panels The ideal candidate will be entrepreneurial, enthusiastic, ambitious and will be actively involved in a range of business development activities, including attending networking and other BD events, supporting on tenders/pitches, and writing sector-relevant articles for our own and external publications. Strong technical drafting, research and communication skills, with good attention to detail and a commercial/pragmatic approach are essential qualities, as is the ability to deliver a strongly client-focussed service, giving clear, timely and practical legal advice on often complex, technical areas of Employment law. We are looking to recruit an individual who has the drive and commitment to assist Birketts in the continued growth and development of our Employment practice and to become an essential core member of our team. • Qualified Solicitor of at least 10 years PQE, • Proficient level of experience as an Employment law specialist, • A keen interest in business development and growth opportunities. At Birketts, our culture is driven by ambition and a commitment to positively impact all the communities we serve. We are dedicated to the success, development, and wellbeing of our colleagues, helping them achieve their goals and seize the opportunities that come with our growth. Alongside a flexible and inclusive work environment, we offer the following core benefits: *Legal Director only: • 30 days holiday (FTE) plus Bank Holidays, • Long Service holiday award 1 extra week every 10 years continuous service, • Private Healthcare with BUPA (offered after probation is passed), • Scottish Widows Pension Scheme (5% employer / 5% Employee), • Staff Profit Share and Individual Performance Bonus Scheme, • Salary sacrifice (Pensions, Staff Profit Share), • Life Assurance - 4 x salary / Permanent Health Insurance, • Paid CSR Day, • Enhanced Maternity/Paternity Leave, • Subsidised gym membership, • Electric car scheme, • Agile/Hybrid Working Policy Please note that this job profile is not an exhaustive list of duties but merely an outline of the key components of the role. You may be required by your line manager to take on additional responsibilities when requested. Birketts is committed to being an Equal Opportunity Employer. Our policy is unequivocal: we do not tolerate discrimination based on age, disability, sex, race, religion or belief, gender reassignment, marriage or civil partnership, pregnancy or maternity, or sexual orientation. We pride ourselves on being an inclusive organisation that actively promotes equality of opportunity for all, valuing the right mix of talent, skills, and potential. We welcome applications from a diverse range of candidates, and selection for roles is based solely on individual merit.

Term Type:PermanentDepartment:Residential Development Birketts is a full service, UK Top 50 law firm. With a heritage spanning 160 years, we have more than 700 lawyers and legal professionals based in Bristol, Cambridge, Chelmsford, Ipswich, London, Norwich and Sevenoaks. We advise businesses, government and public sector organisations and individuals in the UK and internationally across four principal practice groups: Real Estate, Corporate Services, Dispute Resolution and Private Client. We are defined by our Next Level Law proposition. We work with our clients as a proactive partner, horizon scanning and thinking ahead to the changes, challenges or opportunities that they may face. Next Level Law is also applied to our people. Our collegiate culture means everyone is encouraged to achieve their next level in everything they do. RollOnFriday recently ranked us as the 5th best law firm to work at in 2024. With our ambition to succeed, comes a strong desire to make a positive contribution to the communities we serve, and we are committed to delivering the objectives set out in our ESG strategy. Diversity plays an integral part in all that we do, with female partners comprising 40% of our partnership. The Residential Development Team at Birketts is expanding. The team includes 5 partners and 40 other fee earners at all levels working collaboratively together across six of Birketts seven offices specialising in the acquisition, sale and development of land for an array of national and SME Residential Developers and Registered Providers . The team also works closely with other Birketts teams, which includes full support from tax, planning, environmental, construction and Real Estate litigation teams. The Residential Development Team sits within Birketts highly regarded and one of the UKs largest dedicated Real Estate teams. Our property lawyers are particularly experienced in dealing with development and investment, planning, secured lending and landlord and tenant matters. The successful candidate will be responsible for maintaining and growing client relationships, ensuring the delivery of high-quality legal services and contributing to the strategic direction and success of the firm. You willbe responsible for: • Ensuringclient needs are met with the highest standard of professionalism and efficiency, • Maintaining and growing client relationships and contributing to the strategic direction and success of the firm., • Leadingand mentoringa team of junior lawyers, fostering a collaborative and supportive work environment., • Participatingin networking events,conferencesand other business development activities to promote the firms services. You will have: • Aminimum of 8 years PQE in a professional legal environment, • A proven track record of advising high net worth clients, • Ability to mentor junior team members and contribute to team development Any information provided in relation to PQE should be used for guidance only and will not be determinative in the recruitment decision. Applicants will be considered on their individual merits. At Birketts, our culture is driven by ambition and a commitment to positively impact all the communities we serve. We are dedicated to the success, development, and wellbeing of our colleagues, helping them achieve their goals and seize the opportunities that come with our growth. Alongside a flexible and inclusive work environment, we offer the following core benefits: • 30 days holiday (FTE) plus Bank Holidays, • Long Service holiday award 1 extra week every 10 years continuous service, • Private Healthcare with BUPA (offered after probation is passed), • Scottish Widows Pension Scheme (5% employer / 5% Employee), • Staff Profit Share and Individual Performance Bonus Scheme, • Salary sacrifice (Pensions, Staff Profit Share), • Life Assurance - 4 x salary / Permanent Health Insurance, • Paid CSR Day, • Enhanced Maternity/Paternity Leave, • Subsidised gym membership, • Electric car scheme, • Agile/Hybrid Working Policy Please note that this job profile is not an exhaustive list of duties but merely an outline of the key components of the role. You may be required by your line manager to take on additional responsibilities when requested. Birketts is committed to being an Equal Opportunity Employer. Our policy is unequivocal: we do not tolerate discrimination based on age, disability, sex, race, religion or belief, gender reassignment, marriage or civil partnership, pregnancy or maternity, or sexual orientation. We pride ourselves on being an inclusive organisation that actively promotes equality of opportunity for all, valuing the right mix of talent, skills, and potential. We welcome applications from a diverse range of candidates, and selection for roles is based solely on individual merit.

This job is with Driver and Vehicle Standards Agency , an inclusive employer and a member of myGwork – the largest global platform for the LGBTQ+ business community. Please do not contact the recruiter directly. About the job Job summary Can you demonstrate excellent organisational skills, with the ability to prioritise effectively in a fast-paced environment? Are you confident using a range of Microsoft Office 365 tools, including Forms and Live Events, as well as Word, Excel and PowerPoint? Do you have a clear understanding of corporate risk management and governance? If so, we would love to hear from you! The Driver and Vehicle Standards Agency (DVSA) helps keep Britain moving, safely and sustainably. We do this by helping people through a lifetime of safe and sustainable journeys, helping them keep their vehicles safe to drive, and protecting them from unsafe drivers and vehicles. We're working hard to: • make roads safer, • improve services for our customers, • make road transport greener and healthier, • harness the potential of technology and data, • Employer pension contribution of 28.97% of your salary. Read more about Civil Service Pensions here, • 25 days annual leave, increasing by 1 day each year of service (up to a maximum of 30 days annual leave), plus 8 bank holidays a privilege day for the King's birthday Find out more about what it's like working at Driver and Vehicle Standards Agency - Department for Transport Careers Job description The post-holder is responsible for ensuring all administrative support activities are carried out efficiently and effectively for the Driver Services Business Services team, with a strong service focus that contributes to the effective delivery of Operations frontline services. The postholder will provide an efficient and professional service to the driver service directorate. Your responsibilities will include, but aren't limited to: • Manage the Operations mailboxes, ensuring requests are triaged, escalated, and monitored as required., • Act as secretariat for key meetings and networks across Operations, drafting agendas, arranging guest attendance, taking action points, and assigning these to responsible owners., • Extract and share information pertaining to driver services risks with internal stakeholders as requested., • Support the running of driver services events, identifying suitable venues, and assisting with the running of events on the day., • Contribute to the development of robust business cases by obtaining relevant information on costs, performance, MI etc. Person specification Required experience: To be successful in this role you will need to have the following experience: • Excellent organisational skills including ability to prioritise effectively, • Experience of working closely with Senior Managers in an administrative role., • Experience in a range of administrative and project related roles., • Experience in a range of Microsoft IT packages including Office 365 tools such as Forms and live events, Word, Excel and PowerPoint. Working hours, office attendance and travel requirements Full time roles consist of 37 hours per week. This role is suitable for hybrid working, which is a non-contractual arrangement where a combination of workplace and home-based working can be accommodated subject to business requirements. The expectation at present is a minimum of 60% of your working time a month will be spent at either your designated workplace (one of the locations cited in the advert) or, when required for business reasons, in another office/work location/visiting stakeholders. Your designated workplace will be your contractual place of work. There may be occasions where you are required to attend above the minimum expectation. If you have a question about hybrid working, part time/job share hours, flexible working, travelling for work, or require a reasonable adjustment, please contact the Vacancy Holder during the recruitment process to avoid possible disappointment later in the process should your working arrangements not be compatible with the requirements of the role (see below for contact details). Visa Sponsorship Please note that we do not hold a UK Visa & Immigration (UKVI) Skilled Worker Licence sponsor and are unable to sponsor any individuals for Skilled Worker Sponsorship. Candidates must ensure they have the appropriate rights to work in the UK before application. Behaviours We'll assess you against these behaviours during the selection process: • Working Together, • Delivering at Pace, • Communicating and Influencing, • Making Effective Decisions Benefits Alongside your salary of £30,485, Driver and Vehicle Standards Agency contributes£8,831 towards you being a member of the Civil Service Defined Benefit Pension scheme.Find out what benefits a Civil Service Pension provides. Being part of our brilliant Civil Service means you will have access to a wide range of fantastic benefits: • Employer pension contribution of 28.97% of your salary. Read more about Civil Service Pensions here, • 25 days annual leave, increasing by 1 day each year of service (up to a maximum of 30 days annual leave)., • 8 Bank Holidays plus an additional Privilege Day to mark the King's birthday., • Access to the staff discount portal., • Excellent career development opportunities and the potential to undertake professional qualifications relevant to your role paid for by the department, such as CIPD, Prince2, apprenticeships, etc., • Joining a diverse and inclusive workforce with a range of staff communities to support all our colleagues., • 24-hour Employee Assistance Programme providing free confidential help and advice for staff. Things you need to know Artificial intelligence Artificial intelligence can be a useful tool to support your application, however, all examples and statements provided must be truthful, factually accurate and taken directly from your own experience. Where plagiarism has been identified (presenting the ideas and experiences of others, or generated by artificial intelligence, as your own) applications may be withdrawn and internal candidates may be subject to disciplinary action. Please see our candidate guidance (opens in a new window) for more information on appropriate and inappropriate use. Selection process details This vacancy is using Success Profiles (opens in a new window), and will assess your Behaviours and Experience. How to apply: Our selection process ensures a comprehensive assessment of each applicant's skills, and potential fit within our organisation. The selection process for this role will be: Stage 1: Sift of a personal statement Stage 2: Interview You must be successful at each stage to progress to the next stage. Stage 1: Sift At sift, you will be assessed against the following Success Profile elements: • Experience - you will be asked to provide a personal statement (1000-word count). Please provide evidence of your Experience of the following:, • Excellent organisational skills including ability to prioritise effectively, • Experience of working closely with Senior Managers in an administrative role., • Experience in a range of administrative and project related roles., • Experience in a range of Microsoft IT packages including Office 365 tools such as Forms and live events, Word, Excel and PowerPoint. Candidates who pass the initial sift may be progressed to a full sift or progressed straight to assessment/interview. The sift will take place from 26/05/2026 Stage 2: Interview At interview stage, you will be assessed against the following Success Profile elements: This interview will be conducted online via Microsoft Teams. Further details will be provided to you should you be selected for interview. You can find out more about our hiring process, how to apply, and application and interview guidance on our careers site (opens in a new window). Please note that we will try to meet the dates set out in the advert. There may be occasions when these dates will change. Further information on the selection process We will also hold a 12-month reserve list for this role, which may lead to potential opportunities beyond the role you applied for. You can read more about our reserve lists here. Reasonable Adjustments As a Disability Confident Leader employer, we are committed to ensuring that the recruitment process is fair, accessible and allows all candidates to perform at their best. If a person with a visible or non-visible disability is substantially disadvantaged, we have a duty to make reasonable changes to our processes. Complete the "Assistance required" section in the "Additional requirements" page of your application form to tell us what changes or help you might need during the recruitment process. For instance, you may need wheelchair access at an interview, or if you're deaf, a Language Service Professional. If you need a reasonable adjustment so that you can complete your application, you should contact Government Recruitment Service via as soon as possible before the closing date to discuss your needs. Document Accessibility If you are experiencing accessibility problems with any attachments on this advert, please contact the email address in the 'Contact point for applicants' section. This job advert contains links to the DfT Careers website. Our website provides useful guidance and information that can support you during the application process. If you cannot access the information on our website for any reason, please email for assistance. Further Information For more information about how we hire, and for useful tips on submitting your application for this role, visit the How We Hire page of our DfT Careers website. You can find detailed information about the recruitment process and what to expect when applying for a role. Pre-employment Checking Applicants who are successful at interview will be, as part of pre-employment screening, subject to a check on the Internal Fraud Database (IFD). This check will provide information about employees who have been dismissed for fraud or dishonesty offences. This check also applies to employees who resign or otherwise leave before being dismissed for fraud or dishonesty had their employment continued. Any applicant's details held on the IFD will be refused employment. A candidate is not eligible to apply for a role within the Civil Service if the application is made within a 5-year period following a dismissal for carrying out internal fraud against government. If your application is successful but you have been dismissed from the Civil Service within the last 12 months, your application could be removed at the pre-employment checking stage. All External applicants and current employees of accredited non-departmental public bodies (NDPBs) will be required to undergo a Social Media Check. A Social Media Check is a review of your publicly available online activity, typically across platforms like LinkedIn, Facebook, X (formerly Twitter), Instagram, and others. The purpose is to identify any public posts or content that could raise concerns for employers, such as: Hate speech or discriminatory behaviour Threats or acts of violence Illegal activity or substance misuse Sexually explicit material Extremist views or affiliations Importantly, this check does not involve hacking into your accounts or accessing private messages. It only considers content you have chosen to make public. Employers use this kind of screening to help ensure their workplace remains safe, inclusive, and aligned with company values. It's not about judging your personality or lifestyle-it's about checking for potential red flags that might affect the role or company culture. If you have questions or concerns about the social media check, we would be happy to explain in more detail what's being looked at and how your data is handled securely and fairly. Feedback will only be provided if you attend an interview or assessment. Security Successful candidates must undergo a criminal record check. People working with government assets must complete baseline personnel security standard (opens in new window) checks. Nationality requirements This job is broadly open to the following groups: • UK nationals, • nationals of the Republic of Ireland, • nationals of Commonwealth countries who have the right to work in the UK, • nationals of the EU, Switzerland, Norway, Iceland or Liechtenstein and family members of those nationalities with settled or pre-settled status under the European Union Settlement Scheme (EUSS) (opens in a new window), • nationals of the EU, Switzerland, Norway, Iceland or Liechtenstein and family members of those nationalities who have made a valid application for settled or pre-settled status under the European Union Settlement Scheme (EUSS), • individuals with limited leave to remain or indefinite leave to remain who were eligible to apply for EUSS on or before 31 December 2020, • Turkish nationals, and certain family members of Turkish nationals, who have accrued the right to work in the Civil ServiceFurther information on nationality requirements (opens in a new window) Working for the Civil Service The Civil Service Code (opens in a new window) sets out the standards of behaviour expected of civil servants. We recruit by merit on the basis of fair and open competition, as outlined in the Civil Service Commission's recruitment principles (opens in a new window). The Civil Service embraces diversity and promotes equal opportunities. As such, we run a Disability Confident Scheme (DCS) for candidates with disabilities who meet the minimum selection criteria. The Civil Service also offers a Redeployment Interview Scheme to civil servants who are at risk of redundancy, and who meet the minimum requirements for the advertised vacancy. Diversity and Inclusion The Civil Service is committed to attract, retain and invest in talent wherever it is found. To learn more please see theCivil Service People Plan (opens in a new window)and theCivil Service Diversity and Inclusion Strategy (opens in a new window). Apply and further information This vacancy is part of the Great Place to Work for Veterans (opens in a new window) initiative. The Civil Service welcomes applications from people who have recently left prison or have an unspent conviction. Read more about prison leaver recruitment (opens in new window). Once this job has closed, the job advert will no longer be available.You may want to save a copy for your records. Contact point for applicants Job contact : • Name : Kirsty Cloke Further information If you feel your application has not been treatedin accordance with the Recruitment Principles and you wish to make a complaint, in the first instance, you should contact Government Recruitment Services via email: If you are not satisfied with the response you receive from the Department, you can contact the Civil Service Commission: Click here () to visit Civil Service Commission

A well established, multi office commercial law firm is looking for an experienced Corporate & Commercial Solicitor to join its growing team. Qualified SRA registered Solicitor with 4+ years' PQE in commercial work. Corporate & Commercial Solicitor - Bristol.

Pro-Tax is seeking a Corporate Tax Manager for their Bristol office, focusing on advisory work with a variety of interesting clients in the field of corporate and international tax. This position involves engaging with management and developing technical skills in a high-performing team, while parti

Aon Corporate are now recruiting for a Client Service Advisor, this is a hybrid role with the flexibility to work both virtually and from our Bristol office. Our clients typically require bespoke insurance programmes and associated risk management and risk transfer services. As a Client Service Advi

This high‑profile, trusted role involves leading executive business support, managing governance and priorities, coordinating high‑level meetings and events, and ensuring the smooth running of our corporate headquarters. Coordinating and organising the office of the Group Chief Executive and sup

The Opportunity An exciting opportunity has arisen for an Associate Structural Engineer to join a growing, design-led civil and structural engineering consultancy in their Bristol office. This is a senior-level position ideally suited to a Chartered Engineer looking to move beyond pure project delivery. You’ll play a key role in client engagement, business development, and team growth — with the chance to shape and build your own team within an established office of around 12 professionals. The consultancy delivers high-quality commercial and residential schemes with a boutique approach, focusing on carefully selected clients, bespoke engineering solutions, and technical excellence — all without the constraints of a large corporate structure. The Role As an Associate Structural Engineer, you’ll take on a position that combines technical leadership with commercial and client-facing responsibilities, helping drive both successful project delivery and the continued growth of the Bristol office. Key responsibilities include: Leading the design and delivery of commercial and residential structural projects Acting as a key client contact and trusted engineering advisor Building and maintaining strong long-term client relationships Supporting business development and securing repeat and new work Mentoring, managing, and growing a team of engineers Maintaining high standards of technical quality and consistency Collaborating closely with architects and multidisciplinary design teams Contributing to the strategic growth and expansion of the Bristol office This role offers genuine autonomy, influence, and the opportunity to build something of your own within a supportive and established business. About You We’re looking for a confident and commercially minded Chartered Structural Engineer who can demonstrate: Chartered status (MIStructE or MICE) Strong experience delivering commercial and residential projects Proven success in client-facing roles and relationship management A track record in business development and winning work Leadership experience, or the ambition to build and lead a team Excellent communication and stakeholder management skills A proactive, entrepreneurial approach What’s In It For You? This consultancy values leadership, trust, and performance, offering: Salary of £65,000 – £70,000 Competitive package including bonus, healthcare, and pension Flexible and hybrid working arrangements Clear progression beyond Associate level The opportunity to build and lead your own team A collaborative, supportive, and design-focused culture High-quality projects without corporate red tape Why This Role? If you’re ready to step into an Associate role — or already operating at this level but looking for a stronger platform — this is a rare chance to take ownership of clients, shape a team, and grow a regional presence within a highly respected consultancy. Interested? Apply in confidence today to find out more

Hard Services Facilities Account Manager Bristol Area £55-60k plus car allowance Great Benefits Are you working in the Hard Services Facilities sector as either an Account Manager or Contract Manager and looking for a new opportunity covering a large contract / account in Bristol. If so this could be for you. This Facilities Management provider are currently recruiting for an Account Manager to oversee the Hard Services on a number of Managed Buildings in and around Bristol. Working closely with the Regional Team the role shall ensure contractual compliance, commercial success and that required safety standards are met. Establishing and maintaining client and stakeholder relationships is pivotal to the success of the role. The portfolio consists of Managed buildings in and around Bristol and Bath. Key Accountabilities Financial / Commercial . · Deliver the cost and revenue expectations of the contract · Ensure timely and accurate invoicing · Partake in central office contract and financial reviews monthly or when required. People · Head up a team providing a hard FM services to 7 buildings ( managed offices with some retail parts ) . The team consists of a team static and mobile engineers · Keeping the Operations Manager fully aware of the contract progress and ensuring immediate notification of any delays, adverse trends or problems needing senior management response Customer Satisfaction · Keep the clients regularly informed and ensure client expectations are managed · Chair regular contract review meeting. and issue notes / minutes, · Maintaining accurate records of communication. · Monitoring the nature and volume of any service failures reported and ensure all justifiable complaints are speedily responded to and resolved · Maintaining a close working relationship with the Client and key stakeholders Corporate Policy & Procedures Implementing and maintaining best practice and continuous improvement on H&S. · Overseeing the Company's Project Control Procedures (for contract project works) · Implement and maintain company values · Review and ensure compliance with safety, environmental and quality control policies. Resource Management · Review and assess supply chain capability and remove/add suppliers where required whilst considering social value aspects of public spend · Review and assess direct staff capability and align with delivery expectations. Technical skills and Knowledge · A proficient knowledge of health & safety and environmental legislation · Fully conversant in Hard Services FM · Have appropriate building services industry experience - preferably including either an electrical or mechanical qualification · Experience in delivering contractual agreements over a varied portfolio · Awareness of SFG 20 Person Specification · Results Driven · High level of communications, control, organising, motivational and management skills · Proactive and committed · Collaborative and Team-based - Ability to delegate · Leadership - Lead by example, demonstrate trust in the team · Expertise in role · Good communication skills For further information on the role and the company please APPLY NOW or get in touch with Gary Cornes for a confidential chat

The Company: Our client is an award-winning, full service, commercial law firm and they are rapidly developing a national reputation for its innovative approach to delivering legal services. They operate in the financial services, leisure, retail & consumer goods, technology & media, renewables, housing and public sectors. Their specialisms are real estate, banking and finance, commercial, corporate, employment, dispute resolution and litigation. The Job: On behalf of our client we are seeking a Temporary Senior Paralegal in Conveyancing / Conveyancer in Bristol Fee earning end to end case work including being responsible for your own cases allocated in accordance with resourcing thresholds, to include some more complex matters Preparation of documentation, liaising with clients, customers (as and when required), third parties to progress cases through the appropriate process within SLA. Drafting correspondence. Reviewing incoming correspondence from third parties. Managing key dates. Ensuring the case management system is accurately updated to allow data capture and MI to be produced. Responsible for delivering an excellent client service through case management. Full financial management of matters with high level of financial hygiene specifically in relation to billing, Undertake work within the regulatory and industry frameworks, policies and procedures. Maintain a culture of positive behaviour and role modelling within the team. Regularly updating clients on case progress and ensuring prompt billing. Ensuring compliance with relevant legislation, company policies, and data protection regulations . The Person: For this role, our client is looking for someone who has previous Conveyancing experience or real estate experience Previous experience of title checking freehold, leasehold and shared ownership properties. Previous experience drafting and providing detailed advice and proposed solutions to clients. Demonstrates a natural empathy/affinity with clients and a good telephone manner Strong numeracy skills. Excellent spelling and grammar. Demonstrates proactivity and attention to detail. The Hours: Monday to Friday 35 hours per week between 8.30am and 6.30pm The Location: Bristol, BS1, no car parking (hybrid working available, 3 days in the office) The Salary: £145 per day The Contract: 3 months with a chance of extending TPBN1_UKTJ

Senior Accountant Location: Central Bristol Salary: £50,000 plus DOE The Opportunity A well‑established independent accountancy practice based in Central Bristol is seeking an experienced Senior Accountant to join its growing business. The firm supports a broad SME client base across a range of sectors and places a strong emphasis on long‑term client relationships, high standards of technical delivery, and practical, commercial advice. The business has grown steadily over time and continues to invest in its people, systems, and client offering. This role offers the opportunity to build a long‑term career within a professional yet friendly environment where individuals are trusted with responsibility and encouraged to develop in line with their strengths and ambitions. The practice is forward‑thinking and growth‑focused, with ongoing opportunities to contribute to both client development and wider business success. The Role This is a hands‑on senior role with significant client contact and autonomy. The successful candidate will manage their own client portfolio while supporting and guiding junior team members. Duties will include: Producing high‑quality client work including: Statutory accounts Management accounts Corporation tax computations VAT returns Payroll General accounting and tax advice UK companies and partnerships Providing technical support to members of the accounting services team Keeping up to date with changes in accounting and tax legislation and advising clients on the impact Assisting with the monitoring of workflow to ensure work is completed accurately and on time Supporting the design and implementation of improved accounting systems for clients, including training client staff Preparing and presenting: Management accounts Budgets Forecasts and cashflows Networking and business development activity to support new client acquisition Overseeing bookkeeping functions and a small payroll bureau where required Technical experience desirable: VAT CIS PAYE OMB personal tax returns About You An experienced general practice accountant who enjoys managing their own client files Comfortable working largely unsupervised, with final review from a senior team member Confident communicating directly with clients and building long‑term relationships Able to handle a busy workload while effectively utilising and supporting the wider team Strong commercial awareness and good judgement on when to escalate matters You may be: Looking for a long‑term role where you are valued as a dependable and capable professional Or seeking to accelerate your career and earnings through business development and portfolio growth Being office‑based and part of a close‑knit, collaborative team will be important to you. Background & Experience Previous experience working within an accountancy practice is essential Strong experience producing full sets of accounts Personal and corporate tax experience required Qualified or qualified‑by‑experience candidates welcomed — skills and experience are the priority This role is not suited to candidates still in training Package Salary of £50,000 plus DOE 6‑month probationary period Scope to further develop the role for the right individual If this role is of interest, please click APPLY

Headford Capital About the Company We are a specialist corporate finance boutique based in Bristol, advising owner-managed businesses and SMEs on M&A, disposals, management buyouts, and capital raises . Typical deal sizes range from £5M£50M across sectors including logistics, manufacturing, technology, and business services. We operate lean, high-performing teams. As a Corporate Finance Manager, youll take ownership of live transactions and work directly with clients from day one. Role Overview As Corporate Finance Manager, you will lead the day-to-day execution of M&A and fundraising mandates, manage junior team members, and act as a key point of contact for clients and advisors. Youll also support origination and business development activities. Key Responsibilities Deal Execution Manage M&A and fundraising processes from mandate through to completion Build and review financial models , valuations, and information memoranda Coordinate due diligence, Q&A, and data room activity Support negotiations and manage communication between buyers, sellers, and advisors Client Management & Origination Maintain day-to-day client relationships on active mandates Prepare pitch materials and proposals for new opportunities Support partners with business development meetings and networking Team Leadership & Compliance Supervise and mentor analysts/associates on modelling and research Review junior work for accuracy and commercial logic Ensure all work meets internal standards and FCA compliance requirements Person Specification Essential 35 years experience in corporate finance, M&A, transaction services, or investment banking Strong financial modelling and valuation skills (DCF, multiples, LBO basics) Experience managing parts of a deal process and client communication Degree (2:1 or above) in Finance, Accounting, Economics, or related field Based in or commutable to Bristol office-based role (5 days/week) Desirable ACA, ACCA, CIMA, or CFA (qualified or part-qualified) Experience with debt advisory, MBOs, or private equity processes Package & Benefits £50,000 base salary Annual performance bonus linked to deal completions and origination Typical OTE bonus: £20,000£50,000 25 days holiday + bank holidays Employer pension contribution Professional qualification support Clear progression path to Director level Small, commercially focused team with high deal exposure and low bureaucracy Why Work in Aztec West Aztec West is one of Bristols leading business parks, offering excellent M4/M5 access, onsite parking, and a strong concentration of HQ and private-equity-backed businesses. How to Apply Please send your CV and a short summary of a deal youve worked on to craig(at)headfordgroup(dot) com - Applications are reviewed on a rolling basis. Applicants must have the right to work in the UK. TPBN1_UKTJ

Are you ready to make a significant impact in a thriving, fast-paced environment? Our client, a leading name in the engineering and MEP sector, is seeking a Senior Buyer / Procurement Manager based out of their Bristol office. With a major "20/30 strategy" driving growth across the South West, this role falls between strategic investment and rapid expansion. You will be part of a "warmer," highly collaborative team, managing diverse projects ranging from regional frameworks to massive industrial developments, such as the new The Role As a Senior Buyer in the Bristol region, you will work alongside an established Procurement Manager but will be expected to operate with high levels of autonomy. Your focus will be: Operational Ownership: Managing the full MEP procurement cycle for multiple high-value projects across the South West. Team Leadership: This role is designed for a Senior Buyer who can mentor junior staff (the team currently includes an internal mover from an assistant role) and eventually have 1–2 direct reports. Subcontractor Specialist: Developing and maintaining robust relationships with M&E subcontractors and suppliers to ensure project delivery. Market Agility: Navigating a fast-changing project landscape, ensuring procurement processes keep pace with the region's rapid growth. You We are looking for a technically strong MEP Contractor Buyer who can "hit the ground running": Experience: Proven background in MEP procurement, specifically working for a contractor or a Tier 1 builder M&E Focus: You must be an "out and out" MEP buyer. We are looking for someone who understands the technical supply chain, not just general construction materials. Independence: You need to be a self-starter who can manage your own workload without constant supervision. Adaptability: Comfortable in a "warmer," team-oriented environment that is undergoing rapid change. Location: Based in or able to commute to the Bristol office for face-to-face collaboration. What's in it for you? This company offers a supportive, non-corporate culture that rewards impact and offers a "business within a business" feel. Salary: £60,000 – £67,000 Car Allowance: £4,800 per annum. Healthcare: Private healthcare (AXA). Annual Leave: 25 days, plus the option to buy or sell up to 5 days. Wellbeing: Dedicated wellbeing days during summer months and a suite of flexible benefits (gym, memberships, etc.). Apply Now! Interviews are taking place now, with the first stage ideally being face-to-face in Bristol. To apply for the position of Senior Buyer in Bristol, click ‘Apply Now’ and send your CV to Olivia Blake

Audit Senior Central Bristol Up to £50,000 – Dependent on Experience Full-time | Monday to Friday, 9:00am – 5:30pm A well-established and respected accountancy practice in central Bristol is seeking an experienced Audit Senior to join its collaborative and professional team. The firm works with a varied and high-quality client portfolio and is known for delivering excellent audit, compliance and advisory services while building long-term client relationships. The practice offers a supportive and inclusive working environment with a strong focus on technical quality, collaboration and continuous professional development. This role provides genuine scope for responsibility and long-term career progression. The Role You will be responsible for managing and delivering audit engagements from planning through to completion, acting as a key point of contact for clients throughout the process. Key responsibilities include: Managing and delivering statutory audit engagements end to end Reporting directly to Director level Working with owner-managed businesses and groups with turnovers up to £100m Building and maintaining strong client relationships Managing deadlines, budgets and workflow Liaising with other departments and team members Involvement in statutory and non-statutory audits and wider compliance work Exposure to non-audit and ad-hoc projects, including due diligence and corporate finance support About You This role would suit a confident, client-facing auditor with strong technical skills and a hands-on approach. Essential experience: 2–3+ years’ experience within audit Strong experience auditing owner-managed businesses Confident liaising directly with clients Qualified or at final stages Proficient with Microsoft Office Desirable experience: Statutory accounts preparation Corporate tax exposure VAT or management accounting experience What’s on Offer Salary up to £50,000 (DOE) Full-time, office-based role 6-month probationary period Long-term career development within a close-knit, supportive team Click to apply

On behalf of our client, we are seeking to recruit a Supply Chain & Quality Specialist on an initial 8 -month contract. As the Supply Chain & Quality Specialist, you will need to be autonomous in supporting the UK Supply Chain Systems & Equipment's organization to continuously improve in supply chain management ways of working and developing supplier capability and maturity Role: Supply Chain & Quality Specialist Pay: £40 per hour Via Umbrella Location: Filton - 60% onsite Contract: Monday- Friday, 35 Hours per week,8 Months contract IR35 Status: Inside Security Clearance: BPSS Responsibilities Developing and deploying APQP across Major Modifications to ensure industrial maturity Coaching and upskilling the Supply Chain Quality Managers community Supplier Continuous Improvement & Development Delivery & Quality Supplier Operation Support Supporting the SCQM community to implement robust continuous improvement plans through Supplier Business Improvement Plan Methodologies Focal point for Supplier APQP Self assessments and linked projects in Supplier Business Improvement Plan Methodologies Facilitator for Quality Tools, Techniques and Methodologies for supplier development Supporting SCQM facing complex quality supply chain issues impacting the company's industrial flow Standardising Quality Tool ways of working across Systems & Equipment scope Supporting Corporate Assessments designed to assess the industrial maturity of the suppliers like IPCA's, CCP's and Concession processes Essential Skills: Understanding of Change Request Industrial Implementation Supply Chain & Quality Background Knowledge of PPS (Practical Problem Solving) methodologies such as 8D / 9S, Ishikawa, 5why, etc. Strong APQP experience Experience of transfers of work. Autonomous and pro-active approach Willingness to get involved and drive change within the organisation Ability to work on own initiative If you are interested in applying for this position and you meet the requirements, please send your updated CV to: Natalie Dalkin at Line Up Aviation Line Up Aviation has carved its own place in the recruitment of Aviation and Aerospace personnel all over the world for more than 30 years. We work with some of the industry's best known companies who demand the highest standard of applicants. "Follow @LineUpAviation on Twitter for all of our latest vacancies, news and pictures from our busy UK Head Office. Interact with us using the #LineUpAviation tag at anytime! Thank you for your follow

HGV CLASS 2 DRIVER Location: Bristol CompetitivePay +OvertimeAvailable Full-Time |Permanent/Contract Looking forsteady, well-paid driving workwith an immediate start? Were hiring experiencedHGV Class 2 Driveron behalf of a leading commercial relocations companyto join a busy and friendly transport team in Bristol. Whether youre looking forongoing workorapermanent role, this is a great opportunity withconsistent hoursandweekly pay. This is an excellent opportunity to join a well-established business delivering professional office and corporate relocation services. The role offers stable work on a flexible basis,regular overtime opportunities, and the chance to work as part of a professional relocation team supporting major corporate clients. If you are an experiencedClass 2 Driverlooking for a varied role beyond standard delivery driving, this could be the perfect opportunity. The Role: As anHGV Class 2 Driver, you will be responsible for the safe transportation of office furniture, IT equipment, and commercial assets between client locations across London. You will also work closely with the relocation teams to support office moves and installations. Key Responsibilities: DrivingHGVClass2 vehiclessafelyandefficiently in and around London andacross the South of the UK. Transportingofficefurniture,ITequipment,andbusinessassets Assistingwithloadingandunloadingvehiclesaspartoftherelocationteam Ensuringgoodsaresecuredandprotectedduringtransit Carryingoutdailyvehiclechecksanddefectreporting Completingdeliverypaperworkandjobdocumentation Providingaprofessionalservicewhenworkingonclientsites Followinghealth &safetyproceduresandmanualhandlingguidelines WhatWe'reLookingFor: ValidHGVClass2 (CategoryC)licence Driver CPC Qualification Digital Tachograph Card Goodlevelofphysicalfitness(roleinvolvesmanualhandling) Reliable,professional,andteam-orientedattitude Flexibilityforearlystarts What WeOffer: Competitivesalary Flexible,permanentemployment Traininganddevelopmentopportunities CompanyuniformandPPE Opportunitytoworkwithawell-establishedcommercialrelocationspecialist APPLY NOW IfyouareareliableHGVClass2Driverlookingforalong-termopportunitywithafantastic company,wewouldlovetohearfromyou. TPBN1_UKTJ

Senior Partnerships Officer Location: Remote (UK based) Bristol / London office attendance 1 day a week. Salary: £34,200 (Grade 4) per year (plus Inner London Weighting of £3,483.94, if eligible) Length of contract: Permanent Hours per week: 37 hours Closing date: We reserve the right to adapt the advert at any time per organisational circumstances and to close this vacancy early for the role. Therefore, if you are interested, please submit your application as early as possible. Interviews: Interviews will be scheduled on a rolling basis Who are Women’s Aid? Women’s Aid is the national charity working to end domestic abuse against women and children. We are a federation of just under 180 organisations which provide over 300 local lifesaving services to women and children across England. For 50 years we have campaigned on behalf of our members and survivors to shape policy and practice, and to raise awareness of domestic abuse. Our support services, which include the Survivors’ Forum, the No Woman Turned Away Project, the Survivor’s Handbook, Love Respect (our dedicated website for young people), the national Women’s Aid Directory and our advocacy projects, help thousands of women and children every year. Purpose of the Senior Partnerships Officer role: As Senior Partnerships Officer, the successful candidate will play an integral role in delivering against strategy to secure vital income from current and future partners including earned and fundraised income. The role will be responsible for building and maintaining a dynamic pipeline of prospects through research, relationship development and stewardship, with corporate supporters. There may also be some involvement Major/mid-level Donors on some level. The post holder will lead on maximising support through a variety of corporate fundraising streams from drafting compelling applications and tailored approaches, to developing persuasive cases for support that align with Women’s Aids’ strategic priorities and increase organisational income. The post holder will ensure that funded activities are impactful, measurable and clearly communicated, providing meaningful reporting to both internal stakeholders and external partners. The post holder will build and maintain strong internal and external relationships, developing a thorough understanding of Women’s Aid’s work, business plans and strategic priorities, and effectively articulating its values, mission and purpose to a wide range of audiences. About the Partnerships Team Women’s Aids’ Partnerships Team is currently in an exciting period of growth and development, with of focus on strengthening and diversifying income streams. While a number of valued and established partnerships are in place, there is a strong emphasis on new business development and expanding the pipeline of corporate partnerships. The team works collaboratively to deliver a shared income target and is focused on building long-term, high-value relationships that align with Women’s Aids strategic priorities. Key duties and responsibilities of the Senior Partnerships Officer: Work closely with the Partnership & Development Manager and Head of Fundraising to continually develop and maintain strategy for maximising income from corporate supporters. Line manage two partnerships officers, including setting objectives, conducting regular one-to-ones and appraisals, and supporting their ongoing development to maximise team performance and income generation. Support the Partnerships and Development Manager in monitoring performance, producing income forecasts, and reporting on progress to senior leadership. Identify, research and cultivate new corporate prospects and new funding opportunities, using our database and extended networks (via Trustees, existing supporters, advisory groups, operational contracts etc.) to build a strong pipeline of opportunity. Seek new innovative ways to maximise income generation opportunities via earned income through the sale of Women’s Aid training packages and products/services. Act creatively and innovatively to not miss out on opportunities in a fast-paced funding environment. Lead on compelling proposals, pitches and cases for support to secure high-value partnerships (including sponsorships and charity of the year opportunities). Ensure all partnerships align with brand, ethical, and compliance standards. What we are looking for in our Senior Partnerships Officer: Proven experience of creating meaningful multi-year partnerships, securing sizeable donations Experience of acquiring and managing corporate Charity of the Year partnerships Good knowledge of the funding landscape and of best practice in multiple areas of fundraising (trusts and foundations, corporate and major donor). Benefits of joining us as our Senior Partnerships Officer include: Generous Annual Leave: 25 days + 2 Company Holidays + 8 UK Bank Holidays, with an extra 1 day per year after 1 year of service, up to a maximum of 5 additional days. Valuable Pension Benefits: a generous 7% employer contribution. Flexible Working: remote working, a generous TOIL scheme, and family-friendly policies NB: Women only need apply under schedule 9 (Part 1) of the Equality Act 2010 All posts, including remote posts, must be based in the UK. Women’s Aid is committed to quality, equality, and valuing diversity. Applications are particularly welcome from Black and minoritised women. Please see the Reasonable Adjustments Statement on Job Description. Please read our Single Sex Statement on the Women’s Aid Website Please note that applications will be reviewed, and interviews arranged, on a rolling basis, so for the bestchance of success, please apply ASAP

Design Manager / Senior Design Engineer – HV Grid Connections Salary: £55,000 – £70,000 + package Location: Bristol (hybrid working) The Opportunity An opportunity has arisen to join a fast-growing engineering contractor delivering high voltage grid connection and renewable energy projects across the UK. This is a business that has established itself quickly within the market, growing from circa £8m turnover in its first year to over £15m currently, with a clear plan to reach £28m in the next financial year. A significant proportion of that revenue is already secured, providing strong stability alongside continued growth. They specialise in delivering 132kV grid connections for solar and battery energy storage developments, operating on a full turnkey basis from design through to commissioning. With expansion underway into transmission-level private connections and international markets, the business is entering a key phase of development. This role will suit a Design Manager or Senior Design Engineer looking to move into a broader, more influential role within a growing organisation. The Culture The business operates with a genuinely close-knit team dynamic, built around individuals who have worked together previously and continue to do so in a collaborative and supportive way. It is not a corporate environment. The structure is relatively flat, communication is direct, and individuals are trusted to take responsibility for their work. There is a strong emphasis on creating a workplace where people enjoy coming to work, supported by regular team events and a relaxed but professional atmosphere. As the business grows, maintaining this culture remains a key priority. The Role This is not a traditional design role focused purely on production. The position centres on managing and coordinating the full design lifecycle across projects, ensuring alignment between civil, electrical and earthing disciplines. Key responsibilities include: • Managing design from initial data capture through to as-built, • Coordinating external design consultants and subcontractors, • Ensuring integration across all design disciplines, • Reviewing and validating design outputs, • Supporting overall project delivery alongside operations teams About You You will have experience within substation or grid connection projects and a strong understanding of how design integrates into overall delivery. Key experience: • Substation or high voltage project experience, • Design coordination or design management exposure, • Understanding of full project lifecycle, • Ability to work across multiple disciplines A civil engineering bias would be highly advantageous, although candidates with broader coordination experience will also be considered. Working Arrangements • Bristol-based, 3 days per week in the office, • Hybrid flexibility outside of this, • Limited site travel as required Package • £55,000 – £70,000 salary, • 30 days holiday plus bank holidays, • Private healthcare (AXA) after probation, • 5% pension contribution, • Death in service (4x salary) This role does not include a car allowance. Additional benefits include company events, team activities and a strong emphasis on a positive working environment. Why This Role This is an opportunity to: • Join a growing business at a key stage of development, • Play a central role in shaping the design function, • Work within a close-knit, collaborative team, • Move into a broader role with greater influence and responsibility Process Two-stage interview process with flexibility on format and quick decision-making

About the company: We employ approximately 50 staff across its offices in London, Bristol, Leeds, and Glasgow. We provide Quantity Surveying, Project Management, and CDM Consultancy Services. Our work spans the retail, commercial/office, leisure, and residential sectors, with extensive experience across a wide variety of project types. Key Requirements Qualifications • Degree in Quantity Surveying – Essential, • APC Candidate or working towards MRICS – Desirable Skills and Personal Attributes • Proficient in Microsoft Word, Excel, and Outlook – Essential, • Well presented and professional – Essential, • Proactive, flexible, and resilient – Essential, • Strong communication and interpersonal skills – Essential, • Highly motivated and eager to take on new challenges – Essential, • Organised, with the ability to meet deadlines – Essential, • Able to work independently and collaboratively within a team – Essential, • Experience in multidisciplinary working environments – Essential, • Capable of managing a dynamic workload that can change at short notice – Desirable, • Strong report writing skills – Desirable Main Responsibilities You will be responsible for delivering the full Quantity Surveying service from feasibility through to final account management, including: • Contract Experience – Working with traditional JCT contracts (typically without quantities, including CDPs, or Design and Build Contracts)., • Feasibility and Cost Planning – Feasibility estimating, approximate quantities, and detailed cost planning using NRM 1 and NRM 2., • Pre-Contract Duties – Design review, value engineering, value management, preparation of tender documentation, tender analysis, and preparation of contract documentation., • Post-Contract Duties – Managing monthly valuations, cost reporting, valuing variations and changes, and agreeing final accounts. May also include life cycle costing., • Client Interaction – Acting as a client-facing representative, attending client review meetings, design meetings, and cost or procurement meetings as required. Our Ethos: We believe in building long-term, mutually beneficial, and enjoyable relationships with clients, consultants, and staff. This approach has supported continuous growth over more than 30 years. Our team ethos is built on honest communication, understanding, trust, and a commitment to delivering the best possible service. Corporate and Social Responsibility Our CSR strategy underpins our management ethos and operations. It focuses on four key areas: • Health and Safety, • Staff Well-being and Development, • Environment and Sustainability, • Community and Charity Involvement Benefits: • Company car, • Company pension, • Employee discount, • Employee mentoring programme, • Life insurance, • Referral programme, • Work from home Work Location: In person

Accountant Opportunities (2 roles available) Salary: £42,000 - £50,000 Location: Southwest/hybrid Contract: Permanent Overview of Accountant opportunities Sellick Partnership is delighted to be working with a key public sector client in the South West to recruit two talented Accountants to join their supportive and collaborative finance team. These roles present an excellent opportunity for fully qualified or part-qualified accountants (actively studying) to join a forward-thinking organisation offering clear progression pathways during a period of significant transformation. There are two positions available as outlined below: Accountant: Capital & Treasury Management Support delivery of a large and complex capital programme Manage borrowing and investment activities Provide expert tax advice, including VAT and IR35 assessments Deliver technical accounting guidance to internal stakeholders Ensure compliance with financial regulations and reporting standards Oversee budget monitoring and year-end close processes Maintain the corporate asset register Act as finance lead on a range of complex projectsAccountant: Technical & Accounting Play a key role in the technical accounting function Lead on the year-end Statement of Accounts, external audit, and statutory returns Support corporate controls improvement and governance Manage grants accounting and Collection Fund reporting Collaborate across departments to ensure timely and accurate financial reportingRequired experience/qualifications for the Accountant positions: CCAB-qualified accountant, or part-qualified and actively studying Experience within public or third sector organisations Proven experience supervising or managing a small finance team Strong technical accounting knowledge and stakeholder engagement skillsBenefits available for the Accountant positions include: 25 days annual leave + bank holidays (increasing with service) Generous public sector pension scheme Flexible and hybrid working arrangements Family-friendly policies Ongoing professional development opportunities Cycle to Work schemeThese are exciting opportunities for accountants looking to take the next step in their career within a dynamic public sector environment. How to apply for the Accountant positions If you believe you have the required experience and qualifications outlined above for the Accountant opportunities, please apply within. Alternatively, if you would like a confidential chat about the role or organisation, please contact Kathryn Evans in the Sellick Partnership Derby office to find out more. Sellick Partnership is proud to be an inclusive and accessible recruitment business and we support applications from candidates of all backgrounds and circumstances. Please note, our advertisements use years' experience, hourly rates, and salary levels purely as a guide and we assess applications based on the experience and skills evidenced on the CV. For information on how your personal details may be used by Sellick Partnership, please review our data processing notice on our website

Overview We are seeking a proactive and detail-oriented Paralegal to join our legal team. The successful candidate will provide comprehensive support to solicitors and fee earners across a range of legal matters. This role is ideal for someone with strong organisational skills, excellent attention to detail, and the ability to work effectively in a fast-paced legal environment. Key Responsibilities • Draft and prepare legal documents, contracts, correspondence, and court bundles, • Conduct legal research and summarise findings for solicitors and senior legal staff, • Manage and maintain client files in accordance with SRA and GDPR requirements, • Liaise with clients, courts, barristers, experts, and third parties professionally, • Handle administrative tasks including filing, billing, and diary management, • Assist with case progression and ensure key deadlines are met, • Prepare documents for court proceedings, hearings, and transactions, • Review and organise disclosure and due diligence documentation, • Support solicitors with client onboarding and compliance procedures, • Maintain confidentiality and professionalism at all times Requirements • Previous experience working within a UK law firm or legal environment preferred, • Law degree, LPC/SQE studies, or Paralegal qualification advantageous, • Strong understanding of UK legal procedures and terminology, • Excellent written and verbal communication skills, • Strong organisational and time management abilities, • Proficiency in Microsoft Office and case management systems, • Ability to work independently and as part of a team, • High level of accuracy and attention to detail Desirable Skills • Experience in [Family Law / Conveyancing / Litigation / Employment Law / Corporate Law etc.], • Familiarity with legal billing systems and document management software, • Experience handling high-volume caseloads Benefits • Competitive salary package, • Hybrid working opportunities, • Pension scheme, • Holiday entitlement plus bank holidays, • Career progression and training opportunities, • Support with professional development where applicable Equal Opportunities We are an equal opportunities employer and welcome applications from all suitably qualified candidates regardless of race, gender, disability, religion, sexual orientation, or age

About the role We have exciting opportunities for Electrotechnical Self-employed Assessors covering various locations across the UK. You will undertake periodic assessments across all customers registered under various electrotechnical schemes to assess their work, resources and ensure they follow the rules and technical requirements relating to scheme membership. You will be expected to work independently following instructions and guidance contained in procedural manuals. About the company UK Assessor offers support to service industry-leading certification services, Building Regulations schemes, products, and support to the construction industry. We are dedicated to providing professional assessment services to a wide range of customers across the building services sector. Quality is the foundation of everything we do. Our clients are Government-recognised and United Kingdom Accreditation Service (UKAS) approved. What youll be doing Undertaking daily/weekly programmed visits, to be centrally scheduled by a member of our administration team Conducting assessments of customers / members ensuring they are compliant to the competent person scheme rules. Undertaking assessments of applicants for registration and conducting assessment visits in other geographical areas, as needed Making recommendations concerning approval, continued registration, deferment or rejection and completing all documentation required by the appropriate procedures Preparing and completing comprehensive assessment reports with specific attention to detail. Delivering all assessment documentation on time Building relationships with customers whilst providing an excellent customer service Assisting in the training of newly appointed Assessors, as requested Complying with the requirements of our Health and Safety Policy Undertaking any other duties as appropriate within your competence Attending regular team meetings Attending training courses and continued professional development. What were looking for Essential High level of technical competence over a wide range of electrical installations Detailed knowledge of BS 7671 and related codes of practice Excellent report writing, numeracy, and IT skills, in particular Microsoft Office Personable and communication skills with the ability to build excellent relationships at all levels. Excellent customer service skills can recognise the customers needs and strives to deliver the best level of customer service. Excellent time management skills with the ability to prioritise workload and meet strict deadlines. Full driving licence Full flexibility and the ability to work out of area when needed. Desirable Knowledge of accreditation criteria Corporate membership of the IET/CIBSE HNC in engineering or equivalent Vocational Assessor qualifications Adult Teaching qualifications What well offer you A competitive day rate Six weeks training Flexibility, with regards to days worked Chance to be a part of an extremely professional assessment team. If you think this is the job for you, then wed be delighted to hear from you! Please send your CV and a covering letter to Totaljobs We are unable to respond to all applicants due to the high volumes of CVs we receive. Therefore, if you do not hear from us, unfortunately, this means youve been unsuccessful on this occasion. TPBN1_UKTJ

Project Manager / Senior Project Manager – HV Grid Connections Salary: £65,000 – £85,000 + car allowance (£500–£600 pcm) + package Location: Bristol (hybrid working) The Opportunity An opportunity has arisen to join a fast-growing engineering contractor delivering high voltage grid connection and renewable energy projects across the UK. This is a business that has established itself quickly within the market, growing from circa £8m turnover in its first year to over £15m currently, with a clear plan to reach £28m in the next financial year. A significant proportion of that revenue is already secured, providing strong stability alongside continued growth. They specialise in delivering 132kV grid connections for solar and battery energy storage developments, operating on a full turnkey basis from design through to commissioning. With expansion underway into transmission-level private connections and international markets, the business is entering a key phase of development. This role will suit a Project Manager looking for greater ownership, visibility and progression within a growing organisation, rather than being one part of a larger corporate structure. The Culture The business has been built by a close-knit group of individuals who have worked together previously, and that has shaped a collaborative and supportive working environment. It is informal without compromising on professionalism. There is a strong sense of trust, accountability and shared responsibility across the team, with people given the autonomy to manage their work without unnecessary layers of process. As the business grows, maintaining this culture is a priority. New hires will be joining a team where relationships matter, communication is open, and there is a genuine focus on enjoying the working environment alongside delivering high-quality projects. The Role This is a true end-to-end Project Manager position with full ownership of delivery. You will be responsible for managing projects from design through to commissioning, ensuring programme, commercial and stakeholder requirements are met. Key responsibilities include: * Full lifecycle project delivery from design through to commissioning * Ownership of programme (no planners in the business) * Budget and commercial management * Managing client, DNO and subcontractor relationships * Leading project teams including QS, design and site delivery Projects are typically greenfield developments ranging from £7m to £20m. About You You will come from a high voltage or ICP background and be comfortable taking full responsibility for projects. Key experience: * 132kV or high voltage substation / grid connection experience * Delivery of turnkey infrastructure or renewable projects * NEC contract experience (Option A preferred) * Programme management using MS Project or Primavera This role would suit a Project Manager or Senior Project Manager, and may also appeal to a Project Director who still enjoys being hands-on in delivery. Working Arrangements * Bristol-based office, 3 days per week * Site visits typically a couple of times per month * Hybrid flexibility outside of this Package * £65,000 – £85,000 salary * Car allowance (£500–£600 per month) * 30 days holiday plus bank holidays * Private healthcare (AXA) after probation * 5% pension contribution * Death in service (4x salary) Additional benefits include regular company events, social activities and a strong team-focused environment. Why This Role This is an opportunity to join a business where you will: * Have genuine ownership of your projects * Be part of a close-knit, supportive team * Progress as the business continues to scale * Work in a less corporate, more agile environment Process Two-stage interview process with a quick turnaround for the right candidate