Corporate office jobs in OxfordCreate job alerts

Reed Finance are recruiting for a Head of Transactional Finance to join a growing, private equity-backed organisation at a key stage of its journey. This role has been created as part of a wider finance team restructure, offering the chance to step into a high-impact leadership position overseeing all transactional finance operations, while partnering closely with senior leadership. Reporting into the Group Finance Director, you will take ownership of transactional finance, treasury operations, and key financial controls, ensuring robust processes and continuous improvement across the function. This is a fantastic opportunity to step into a newly created leadership role where you can genuinely shape how transactional finance operates within the business. You’ll have the autonomy to improve processes, develop your team, and play a key role in supporting future growth. Key Responsibilities: • Lead and develop the transactional finance teams, including Accounts Payable, Accounts Receivable, and treasury support, • Oversee end-to-end procure-to-pay and order-to-cash processes, • Manage cash flow forecasting and treasury activities, including banking relationships and facilities, • Take responsibility for VAT, expenses, and corporate card processes, • Act as a key authorised signatory for payment runs and financial controls, • Provide technical oversight on balance sheet integrity, supporting the Management Accountants team, • Drive process improvements across transactional finance, • Ensure strong governance, controls, and timely month-end processes Essential Experience: • Fully-qualified (ACA/ACCA/CIMA) or strong QBE, • Proven experience managing large transactional finance teams, • Strong background in operational finance and process improvement, • Experience working within international or multi-entity organisations, • Solid understanding of controls, balance sheets, and cash management, • Ideally experience within a private equity-backed business As a person you will be an approachable, personable, and visible leader; resilient and adaptable, with a solutions-focused mindset; and a strong communicator who builds trust across the business. Salary offered is up to £80k plus bonus and good benefits. This business also offers a flexible, open, and accommodating working environment with a positive, supporting, and inclusive culture. Hybrid working is offered with the expectation of min. 2 days in the Abingdon office. Apply today if this sounds like you!

FP&A Manager | Oxford Area | Hybrid (3 Days in Office) | Full Time | Permanent | Salary DOE A rare opportunity has arisen for an FP&A Manager to join a growing AIM-listed technology group with an international footprint and a portfolio of market-leading businesses operating across software, advanced technology and industrial sectors. Working closely with senior leadership and divisional management teams, you'll play a key role in driving financial performance, supporting strategic decision-making and delivering high-quality financial insight across a multi-entity international Group. Your New Role • Lead the annual budgeting, forecasting and long-term planning processes, • Produce meaningful MI, KPI reporting and financial analysis for senior stakeholders, • Support strategic projects, investment decisions and M&A activity, • Deliver detailed variance analysis, identifying trends, risks and opportunities, • Business partner with operational and commercial teams across multiple divisions, • Develop and improve financial planning, modelling and reporting processes, • Build and maintain robust financial models to support decision-making, • Drive continuous improvement across reporting, forecasting and planning activities What You'll Need to Succeed • ACA, ACCA or CIMA qualified, • Previous experience within FP&A, Commercial Finance or a similar analytical finance role, • Strong financial modelling, budgeting and forecasting experience, • Advanced Excel skills and experience working with ERP systems, • Excellent communication skills with the ability to influence senior stakeholders, • Commercially minded with strong analytical and problem-solving abilities, • Experience operating within a multi-entity environment would be advantageous What You'll Get in Return • The opportunity to join a successful, international technology group, • Exposure to senior leadership, strategic decision-making and corporate projects, • Hybrid working (3 days in the office), • Excellent benefits package including a 10% pension contribution, private medical cover, life assurance and 25 days holiday plus bank holidays What to Do Now If you're interested in this opportunity, please apply online or contact Imtiaz Khandokar at The Employment Network for a confidential discussion.

Position Summary The Principal Customer Success Manager (CSM) plays a mission-critical role in empowering Seeq’s most strategic customers to transform how they work and realize the full value of their investment in Seeq. Our focus within Customer Success is to retain and grow, delight, and deliver measurable value across the customer lifecycle. Seeq is in scale-up mode with rapid growth. The ideal candidate has experience building customer success motions in fast-growing environments and working with advanced analytics or industrial intelligence platforms sold and implemented in manufacturing. Seeq sells into O&G, Chemicals, Pharma, Power, MMM, and other process manufacturing industries, partnering with customer personas such as manufacturing leaders (COO, CMO), IT/OT leaders (CDO, CIO, CTO), and manufacturing SMEs (process engineers, production managers, digital transformation leaders) Strategic Customer Leadership • Own a portfolio of Seeq’s largest, most complex, and highest-potential customers, typically spanning multiple geographies, sites, and business units, with multi-million dollar ARR responsibility., • Develop, socialize, and execute strategic success plans that align Seeq’s capabilities to customers’ enterprise-level initiatives (e.g., digital transformation, operational excellence, sustainability), including clear value hypotheses, milestones, and executive-level success metrics., • Lead quarterly and executive business reviews (EBRs/QBRs) that highlight measurable outcomes, tell the value story, surface risks/opportunities, and reset priorities to continue driving value and expansion., • Serve as the primary executive-facing point of contact and trusted advisor, shaping long-term collaboration and ensuring alignment between Seeq’s roadmap and the customer’s strategic direction. Adoption, Value Realization, and Expansion • Drive deep and broad adoption across the customer’s organization by orchestrating programs such as structured onboarding, advanced enablement, communities of practice, user forums, and champion networks, in partnership with Training and Services., • Identify, prioritize, and quantify high-impact use cases; ensure successful deployment, measurement of outcomes, and storytelling of value that leads to advocacy and reference ability., • Own the renewal and commercial strategy for your portfolio, including early and proactive risk identification, mitigation plans, and expansion strategies (upsell, cross-sell, and land-and-expand to new sites, business units, or partner companies)., • Collaborate closely with the account team (Sales, Services, Partners) to build and execute comprehensive account plans, including whitespace analysis, multi-year expansion roadmaps, and executive sponsorship alignment. Customer Advocacy, Escalations, and Internal Leadership • Act as the senior escalation point for high-risk and high-visibility situations, driving coordinated response plans, communicating effectively with executives, and ensuring we emerge stronger in the relationship., • Translate customer feedback and emerging needs into prioritized requirements and feature enhancement recommendations for Product and Engineering, with clear business justification and expected impact., • Champion the “voice of the customer” within Seeq by contributing to roadmap discussions, beta programs, advisory boards, and strategic initiatives focused on the manufacturing and industrial analytics domain., • Mentor and coach other CSMs and cross-functional teammates, sharing best practices in strategic account management, value realization, executive communication, and risk management. Operational Excellence and Data-Driven Management • Use customer health indicators, product usage data, and leading/lagging metrics to continuously assess account performance, identify patterns, and adjust strategy and engagement models as needed., • Systematically document account strategies, risks, and opportunities in our internal systems to ensure transparency, continuity, and alignment across teams., • Contribute to the design and continuous improvement of Customer Success processes, playbooks, and tooling to increase scalability and consistency across the organization., • 8+ years in customer-facing roles for B2B SaaS or industrial intelligence platforms serving multinational or industrial/manufacturing organizations, with a strong track record managing complex enterprise accounts; prior Senior/Strategic CSM or equivalent experience strongly preferred., • Deep experience in process manufacturing industries (O&G, Chemicals, Pharma, Power, MMM) and industrial/manufacturing environments, including time-series/advanced analytics and close collaboration with IT/OT stakeholders., • Proven success owning a multi-million-dollar enterprise SaaS book of business with high renewal rates and consistent expansion across sites, business units, and/or regions., • Significant experience presenting to and influencing Senior Director+, VP, and C-level executives in global industrial organizations, including executive storytelling around value realization and transformation journeys., • Highly data-driven, with demonstrated ability to interpret customer health signals, usage patterns, and business metrics to inform strategy, prioritize actions, and communicate impact., • Adept at translating corporate objectives (e.g., annual reports, strategic plans) into concrete account strategies and success plans, and at gaining alignment from diverse stakeholders around those plans., • Demonstrated experience collaborating with Sales, Services, Product, Training, and Support to build and execute joint account plans that lead to advocacy, expansion, and long-term partnerships., • Strong facilitation, communication, and storytelling skills; able to simplify complex technical and analytical concepts for non-technical stakeholders while maintaining credibility with expert users., • Comfortable operating with high autonomy in ambiguous, fast-changing environments, setting direction for your portfolio and influencing internal priorities without formal authority., • Willingness to travel as needed to support strategic customer relationships and key account milestones., • Bi-lingual or multi lingual strongly preferred: English, French, Spanish. Seeq is a remote-first (only) company founded by serial entrepreneurs. Our executive team and board of directors have extensive experience with successful startup ventures in high-growth environments. We are founded on the idea that companies need better solutions for quickly and easily getting business insight from their industrial process data. Our mission is to provide software and services that convert that data into meaningful information that the business can use to improve profitability. We have a wonderful, kind-hearted, talented team that loves to collaborate, lead by example, and exceed our customers’ expectations. We are certified as a great place to work, an emerging startup, the Technology Fast 500, and Inc. Magazine's Best Places to Work. The Perks of Working at Seeq • Competitive salary plus bonus incentives, • $172,000 USD base salary plus variable, • Approximately £127,000 or €146,000, • Benefits:, • 12-week paid Seeq family leave, • Unlimited PTO, • Internet and mobile phone reimbursements, • Medical benefits, • Group term life insurance, • Short-term and long-term disability insurance pre-tax benefits, • Voluntary vision and dental (ortho), • Vacation bonus program, • Employee Assistance Program, • Generous home office allowance, • The best co-workers (we've analyzed the data, so we know it's true.), • Pet-friendly workspace (your dog will be so happy to have you home), • You love your job! Seeq provides equal employment opportunities (EEO) to all employees and applicants for employment without regard to race, color, religion, sex, national origin, age, disability, or genetics. You must be authorized to work in the country in which you reside. Seeq does not sponsor US F1 or H-1B work visas

Senior Financial Accountant / Finance Manager • Permanent full time role, • Salary circa £70,000 plus bonus, private medical insurance, excellent pension scheme and more!, • Based in Wembley, North West London, • Hybrid working - 3 days in the office A successful and longstanding company based in Wembley is looking for an experienced Senior Financial Accountant to join their finance function. This role will report into the Finance Director and will cover all aspects of finance for a well known SME business. Responsibilities will include: • Delivering statutory accounts for UK operations, • Partner with business areas to provide solid financial support and information, • Provide financial reporting, budgeting and forecasts, • Manage junior finance members, • Corporation tax and liaising with auditors, • VAT returns, • Posting journals, • Month end, • Sales reports To be considered suitable for this role you will need to be at a senior accountant level and have the following skills and experience: • Relevant industry qualification (ACCA, ACA, CIMA), • Strong communication and stakeholder management skills, • Strong system skills along with proficiency in Excel, • Ability to lead and manage junior members of the team, • Knowledge around corporate taxation, • Management and financial accounts preparation and delivery, • Strong ability to translate financial information to senior management

Join Childbase Partnership and be part of something extraordinary. Role: Deputy Nursery Manager (supernumerary). Location: Julia Durbin Day Nursery | Headington, Oxford | OX3 7JU (next to Churchill Hospital). Nursery capacity: 131 places. Contract: Permanent | 37.5 hours/week | 52 weeks/year. Working pattern: Varied shifts Monday-Friday between 07:00-18:30 | Choose a 4 or 5 day week. Salary: £38,356.50-£41,437.50 per annum (pro-rata). Responsible to: Nursery Manager. We’ve been delivering childcare excellence since 1989. Within our 44-day nurseries, Head Office, and Training Academy, EduBase, our ethos is simple: we all belong, we all matter, and we all contribute. We believe in ‘careers, not jobs’, supporting one another to grow and succeed. Why join us? • Generous annual leave: 25 days paid leave per annum (pro-rata), rising to 28 days with length of service, plus paid bank holidays., • Work-life balance: Up to a further 20 paid days off each year through our Partnership Reward Days incentive; take your leave or sell the days you accrue, tax-free., • Childcare discount: 75% discount (or 40% grandparent discount) on your fees at any Childbase nursery, from day one., • Exclusive partner benefits: Long-service rewards, qualification bonuses and retail discounts., • Wellbeing support: Free meals, mental health and occupational health support, flu jabs, eye care vouchers and a free will-writing service., • Career development: Team inset days, access to online training and apprenticeships through our academy. About us • We are employee-owned: Every colleague is a partner with a voice, who helps drive our success; when we do well, we each receive an annual tax-free dividend., • We are number 1: Ranked top of the Nursery World league tables for our Ofsted outcomes., • We are community driven: Supporting causes close to our hearts, we’ve raised more than £3.5 million for charity., • We are environmentally responsible: Building a greener tomorrow our nurseries all hold Green Flag awards and are powered by 100% renewable energy. About you • You are a qualified early years professional: You hold a DfE approved early years qualification at level 3 or above and are currently working in a leadership capacity in an early years environment, ideally as a Third-in-Charge, Assistant Manager or Deputy Manager., • You are passionate about developing your team: You have experience of building and retaining a knowledgeable and happy workforce, using positive role modelling and performance review processes to guide colleagues to deliver outstanding early years practice, promoting the best outcomes for children’s learning., • You are an advocate for safeguarding: You always will ensure the well-being of the children and your colleagues is promoted at all times., • You are collaborative: In partnership with the Nursery Manager, you will achieve occupancy, budget, recruitment and retention targets, implement our corporate plan and uphold the nursery’s reputation within the community, resuming full responsibility of the nursery in the absence of the manager. We are an inclusive employer and we welcome applicants of all ages and backgrounds. We’re committed to FREDIE (fairness, respect, equality, diversity, inclusion, and engagement) and will consider any reasonable adjustments required. If you meet the essential criteria for this role, your application will be automatically shortlisted for review by our Recruitment Team who will determine if an interview is the next step. Applicants must currently reside within a commutable distance of the nursery and hold suitable Right to Work in the UK; VISA sponsorship is not available. Safer recruitment checks apply, which include an Enhanced DBS check. If you’re not early years qualified, visit our Careers Page to explore other opportunities.

Every day, somewhere in the world, important decisions are made. Whether it is a private equity company deciding to invest millions into a business or a large corporation implementing a new strategic direction, these decisions impact employees, customers, and other stakeholders. Consulting and private equity firms come to proSapient when they need to discover knowledge to help them make great decisions and succeed in their goals. It is our mission to support them in their discovery of knowledge. We help our clients find industry experts who can provide their knowledge via interview or survey: we curate this knowledge in a market-leading software platform; and we help clients surface knowledge they already have through expansive knowledge management. We’re seeking an Elixir Developer who’s ready to take on exciting technical challenges and make an impact on a global scale. You’ll play a key role in developing robust, scalable applications that power our industry-leading platform - helping the world’s top firms make smarter, faster decisions. Join a team that values innovation, collaboration, and continuous growth. Our Product & Engineering team spans multiple locations, but we’re excited to be building a vibrant Engineering Hub in Lisbon, Portugal. Being based in or relocating to Portugal is a big plus. We work hybrid, combining flexibility with connection — and we love getting together in the office now and then to collaborate, share ideas, and stay close as a team. Key Responsibilities • Develop and maintain scalable, efficient, and high-quality Elixir web applications., • Design, optimize, and troubleshoot SQL queries and performance issues., • Collaborate with cross-functional teams to design and implement new features and improvements., • Write clean, maintainable, and testable code adhering to industry best practices., • Contribute to architectural decisions and optimize system performance., • Proven experience in building and maintaining Elixir-based web applications (e.g., knowledge of Phoenix)., • Strong understanding of SQL, including profiling and building efficient queries., • Solid problem-solving skills and the ability to troubleshoot complex systems., • BS/MS in Computer Science or equivalent industry experience, • Proficiency in English to effectively communicate with the product team. Bonus Skills • Familiarity with Absinthe (GraphQL) and Oban (Job Processing)., • Knowledge of DevOps practices and deployment pipelines., • Experience working in the SaaS or FinTech industry., • AI/ML/LLMs, understanding of agentic architectures, workflow optimisation, prompt engineering What we can offer you: • Tenure Gifts - Vouchers, extra holiday and sabbaticals for each year of employment., • Health insurance, • Enhanced Maternity & Paternity pay., • Corporate Events - From quarterly gatherings to our annual winter & Summer parties, we love to celebrate, collaborate and have fun together! We are committed to building an inclusive workplace – did you know that marginalized groups are less likely to apply to jobs unless they meet every requirement listed? If you are interested in the above role, but don’t necessarily tick every box, we encourage you to apply anyway – this role could still be a great match! Take a look at our diversity statement _

The Adam Hall Group is an internationally leading manufacturer of event technology, and we are looking for an experienced, commercially driven National Account Manager with a strong background in the rental and live production market. This is not an entry-level role—you will bring proven success in managing key rental accounts, a deep understanding of live event workflows, and the credibility to engage confidently with production companies, dry hire houses, and technical teams at all levels. In this position, you will take ownership of strategic accounts while acting as a trusted advisor across our core brands—Cameo professional lighting, LD Systems audio solutions, and the wider Adam Hall portfolio—quickly operating with confidence across these ranges to support real-world show applications, large-scale projects, and time-sensitive rental demands. These are your tasks: Build and grow relationships with rental companies, production houses, and live event specialists. Present Cameo lighting and LD Systems audio with strong real-world application knowledge. Drive revenue by identifying and converting opportunities across rental, touring, and production sectors. Deliver impactful product demos, shootouts, and on-site evaluations. Maintain CRM usage tracking, customer engagement, and data-driven pipeline management. Understand customer workflows and requirements to provide practical, scalable solutions. Manage key accounts strategically, ensuring consistent engagement and long-term growth. Represent the company at trade shows, industry events, and customer showcases. What you bring with you: Proven experience in B2B sales, with a strong track record of success. In-depth industry expertise in event and stage technology, including system integration and product knowledge. Strong commercial acumen paired with excellent technical proficiency. Experience in simulation and visualization of audio or stage lighting systems is a valuable advantage. Exceptional communication skills, with the ability to simplify and explain complex technical concepts to diverse audiences. Collaborative team player, driven by a shared enthusiasm for event technology. Proficient in PC use, with solid skills in MS Office applications. Self-motivated with a high level of personal responsibility and initiative. Possession of a full, clean driving license and willingness to travel frequently, including regular overnight stays. With us you can expect: DEVELOPMENT AND GROWTH: We offer development and training opportunities in a dynamic medium-sized company. FINANCIAL STABILITY: With us you receive financial benefits such as a performance-related bonus as well as other company benefits. WORK-LIFE BALANCE: A concern that is part of the company's culture, we offer, for example, flexible schedule management, expense coverage, a supportive team environment, etc. WORKING TOGETHER: We are a friendly team with a shared passion for event technology. We focus on building personal connections through team events and networking activities between teams. About Adam Hall Group Adam Hall Group is a stable and internationally leading event technology manufacturer with a clear mission: to enable people to share their passion and beautiful moments with each other through event technology. Every day, more than 380 employees from different nations work with heart and soul and passion on the future of live events. In doing so, we rely on mutual trust, transparency and fair dealings with each other as the values of our corporate culture. As part of the Adam Hall Group team, you can look forward to a creative and inspiring working environment where you can contribute your ideas and be who you are! Because at Adam Hall Group, we believe that creative ideas and products can only come from diversity, equal opportunities and community! Your application has been successfully submitted! _ We appreciate your interest in this position. Unfortunately, you have already applied for this job.

We are currently looking for a talented Senior C++ Developer. In this role, you will interact closely with various departments across our organisation, including the product engineering and customer support teams. As a senior figure, you will also have the opportunity to coach team members and take a leading role in critical software development projects. Key focuses will be contributing to the future technical direction of our main product, gaining deep expertise in our domain whilst promoting modern development practices. Role Responsibilities: • Hands-on C++ software development contributing to the design, maintenance and advancement of complex software, • Stay abreast of the latest developments in C++ and related technologies, contributing to a progressive developer experience, • Mentor and coach junior team members, • Conduct code reviews, embedding quality and promoting best practices, • Collaborate closely with other teams to ensure smooth delivery and knowledge distribution, • Promote a balance between business value, technological improvements, and near-term goals Key Skills: • Expert-level C++ with significant commercial experience, • Strong knowledge of modern features and best practices, • In-depth knowledge of architecture, design, maintainability, scalability and performance, • Excellent collaboration and communication skills, • Industry experience with multi-threading and complex memory management, • Keen interest in continuous improvement and personal development, • Experience with CI/CD pipelines, • Adept in managing legacy code bases, • Experience with higher level languages - specifically Python and C# would be beneficial, • Comfortable working across technology domains and software stacks, • Strong knowledge of Linux and Windows Operating Systems, • Awareness of containerisation and orchestration technologies, • Familiarity with scripting languages, • Experience in collaborative and iterative development approaches, • Bachelor's or Master's degree in Computer Science, Software Engineering, or a related field is required We encourage you to apply even if your experience is not a 100% match with the position. We are looking for someone with relevant skills and experience, not a checklist that exactly matches the job description. We want to help you grow, and in return, you help us grow into a stronger, more inclusive organisation. About Us: We didn’t start out as a traditional security product. In the beginning, Glasswall was one of only two file sanitisation filters in the US Intelligence Community’s highly classified networks. We are rated #1 by the National Security Agency. We designed Glasswall CDR to protect businesses against the most advanced file-based threats. Today, we’re trusted by commercial and government organisations around the world. Inclusion: At Glasswall we believe that diversity of people and thought are central to our purpose. We are committed to making Glasswall a company that is attractive to people of many different backgrounds. This includes diversity in every sense of the word: those with different backgrounds, ages, ethnicities, gender identities, sexual orientations, ways of thinking and those with disabilities or neurodivergent conditions. We therefore welcome and encourage applications from everyone, including those from groups that are under-represented in our workforce. One of our corporate objectives is to ensure that the organisational health of the firm is highly rated by our employees. We believe that this is only possible if we promote a culture of inclusion and respect across out business. Each quarter we survey employees on a range of questions relating to our organisational health. This holds a mirror-up to a business and ensures that we can focus on where we need to do better. We have an Organisational Health Committee, which is chaired by a non-executive position. The panel has been formed to guide the leadership in taking positive action that supports a good work-life balance, family friendly relations and to be inviting to a diverse range of potential employees. We also have a Women in Technology Group which has been formed to promote balance in the way that we communicate with, promote, encourage, and support people across our business. Work/Life Balance: Our team puts a high value on work-live balance. It isn’t about how many hours you spend at home or at work; it’s about the flow you establish that brings energy to both parts of your life. We believe striking the right balance between your personal and professional life is critical to life-long happiness and fulfilment. We offer flexibility in working hours and encourage you to find your own balance between your work and personal lives. Salary and Benefits: • Glasswall offers a competitive salary and incentives package., • We offer flexible and remote working options, with hybrid working from our Central London office., • Office travel and incidental WFH expense coverage., • 25 days holiday (plus public holidays)., • Private Medical Insurance including mental health support and cancer care., • Enhanced sick pay., • Annual investment in training and professional development., • Company sponsored life, critical illness, and income protection insurance., • Contributory pension scheme., • Access to ‘salary sacrifice’ benefits such as Cycle to Work and Tech Schemes. A successful candidate will live in the United Kingdom and is comfortable working from home with some meetings being held in the London office. Glasswall is an equal opportunity employer and does not discriminate on the basis of race, national origin, gender, gender identity, sexual orientation, disability, age, or other legally protected status. Application process: Interested candidates can email jandersen@glasswall.com or visit http://careers.glasswall.com/ to apply.

🚀 We’re on a mission to make money work for everyone. We’re waving goodbye to the complicated and confusing ways of traditional banking. After starting as a prepaid card, our product offering has grown a lot in the last 10 years in the UK. As well as and bank accounts, we offer , , a and in the UK, with more exciting things to come beyond. Our UK customers can also , and _ with us. With our hot coral cards and get-paid-early feature, combined with financial education on social media and our award winning customer service, we have a long history of creating magical moments for our customers! We’re not about selling products - we want to solve problems and change lives through Monzo ❤️ _ ✨ 📍London or Remote UK | 💰£93,500 - £126,500 (based on experience level) + stock options + benefits ⭐Our Legal team We're looking for a Senior Legal Counsel - Employment, Incentives & Pensions to join our team at Monzo and help us build one of the best, most innovative banks in the world. This role will have day-to-day responsibility for advising on employment, incentives and pensions (EIP) related matters in a regulated bank environment. This role will report to Monzo’s Director of Legal - EIP and is part of the Group Centre EIP team in the Legal & Board Governance Collective at Monzo, which supports Monzo Group and its operating entities globally. In this role, you will work at all levels in the organisation and in close partnership with our People, Reward, Risk & Compliance and Finance teams, as well as in collaboration with senior Legal team stakeholders as the business develops into a matrix organisation. You’ll lead on a wide range of EIP related legal matters with opportunities for growth in role as the business scales in the UK and internationally. 🔑You’ll play a key role by... • Providing strategic employment legal advice and commercial solutions on EIP matters impacting the Monzo Group as a whole, as well as its subsidiary legal entities. Work closely and collaboratively with Monzo’s Director of Legal EIP and the other Senior Legal Counsel EIP lawyer, as well as with the broader Group Centre Legal team plus local entity GCs and their teams., • Being a trusted adviser and partner to the People team, including in developing policies, procedures, guidance and templates relevant for a range of EIP legal matters., • Providing EIP advisory legal support to the business as required across the entire employee life cycle - from hiring (including executive service contracts), people processes and departures., • Managing any contentious EIP legal matters in conjunction with external counsel., • Working with Monzo’s Reward team on compensation arrangements and remuneration policies and practices in a bank regulatory compensation framework., • Providing legal support to the corporate and commercial legal functions, including on TUPE., • Supporting international projects and matters in the EU and US as the business continues to scale., • Working proactively and collaboratively with members of the wider Legal, People, Reward, Tax, Risk & Compliance, & Finance Collectives on a variety of EIP related matters., • Developing and implement internal frameworks, processes and procedures to increase the efficiency and scalability of EIP legal advice across the Monzo Group and its subsidiary entities., • Delivering training, share insights from your work, and help educate others on EIP matters., • Managing relationships with our external legal counsel and work with others in the Collective to ensure we are optimising our legal spend on EIP matters and obtaining best value. 🤩 We’d love to hear from you if… • You are an experienced, commercial and pragmatic employment lawyer, with at least 6 years + PQE or equivalent experience., • You have an excellent technical grounding in all aspects of employment law, having spent time in private practice, and ideally time in house at a bank and/or other financial institution., • You have experience advising on employment-related regulatory issues which arise in financial services, such as SMCR and FCA Code of Conduct and wider Remuneration Code matters., • You have experience of advising on incentive structures including share options, plus an awareness of workplace defined contribution pension arrangements., • You are a strategic thinker, a strong communicator and a keen problem solver who can recommend solutions that balance business and risk perspectives., • You are willing to jump in and handle a wide range of EIP related legal issues that may arise even outside your core areas of expertise in an enthusiastic, proactive, and resourceful manner, and can sensibly assess when best to engage external counsel in a cost-effective way., • You are comfortable operating at all levels of the organisation up to the Executive and liaising with a variety of internal and external stakeholders., • You enjoy horizon scanning, proactively assessing risks, and quickly identifying and independently implementing mitigating actions. You are always looking for new ways to improve the efficiency and scalability of legal processes and systems., • You have a dynamic and entrepreneurial approach and are comfortable with the ambiguity of a fast-paced and rapidly-evolving environment., • You’ve an open and curious mind, are passionate about the intersection of banking and technology and are excited to join us for the next stage of our journey at Monzo! Not ticking every box? That’s totally okay! Studies show that women and people of colour might hesitate to apply unless they meet every single requirement. At Monzo, we’re dedicated to creating an inclusive and welcoming team. If you’re passionate about this role and keen to learn and grow with us, we encourage you to apply - even if you don’t have everything that's listed just yet. Drop us your application, we’d love to hear from you! In-house experience in financial services is preferred, but is not essential for the right candidate. PQE is a guide only. 🌈 The application journey has 3 key steps • Recruiter call (potentially followed by an initial call with Director of Legal - EIP), • First stage 1 hour role specific interview, • Second stage 1 hour behavioural interview Our average process takes around 3-4 weeks but we will always work around your availability. You will have the chance to speak to our recruitment team at various points during your process but if you do have any specific questions ahead of this please contact us on _. We’ll only close this role once we have enough applications for the next stage. Please submit your application as soon as possible to make sure you don’t miss out. Your compensation package: 💰£93,500 - £126,500 base salary ➕ stock options ✅ We can sponsor visas 📍This role can be based in our London office, but we're open to distributed working within the UK (with ad hoc meetings in London). ⏰ We offer flexible working hours and trust you to work enough hours to do your job well, at times that suit you and your team 📚Learning budget of £1,000 a year for books, training courses and conferences ➕And much more, see our full list of benefits _ #LI-DH1 Equal opportunities for everyone Diversity and inclusion are a priority for us and we’re making sure we have lots of support for all of our people to grow at Monzo. At Monzo, we’re embracing diversity by fostering an inclusive environment for all people to do the best work of their lives with us. This is integral to our mission of making money work for everyone. You can read more in our , 2023 and 2024 _ We’re an equal opportunity employer. All applicants will be considered for employment without attention to age, ethnicity, religion, sex, sexual orientation, gender identity, family or parental status, national origin, or veteran, neurodiversity or disability status. If you have a preferred name, please use it to apply. We don't need full or birth names at application stage 😊

Following a series of significant new business wins, the Corporate Fundraising Team at CALM are looking to grow. We are looking for an ambitious and experienced account manager who is motivated by results and a natural-born relationship builder. The role will be responsible for managing, growing and extending a portfolio of existing corporate partnerships, and, where appropriate, may be asked to support with new business by attending meetings, pitches and staff votes on an ad hoc basis. This role reports into the Corporate Fundraising Lead. Responsibilities Provide excellent relationship management to a portfolio of corporate partners (worth approx. £20k-100k per annum), including, but not limited to, producing account management plans, setting partnership objectives, supporting fundraising initiatives and employee engagement, thereby significantly contributing to the corporate fundraising budget and strategy. Ensure partnership milestones and fundraising targets are monitored, met, reported on and celebrated with key internal and external stakeholders. Confidently represent CALM at key meetings and events, where public speaking and the delivery of CALM Champion Workshops may be required. Work closely with the Services, Data and MarComms teams to build engaging, accurate and tailored impact reports for partners that encourage long-term support. Continue to seek ways of deepening partner relationships, and spotting opportunities for growth and extensions where possible, contributing to CALM’s strategy of growing repeatable, sustainable income. Devise sustainable exit strategies for partners that leave behind a lasting legacy for CALM. Build strong working relationships and collaborate closely with colleagues across CALM to complement partnership activity. Use data, insight and subject matter expertise to inform team strategy, budgeting and reporting. Support the corporate partnerships team, where necessary, in securing new partnerships. This may involve (but not limited to) providing quotes or case studies, attending meetings or pitches, and canvassing for staff votes. Support the Corporate Fundraising team with administrative tasks and identifying and making improvements to working practice, process and knowledge across the High Value team to drive efficiency, improved ROI and inform strategy. Adhere to GDPR and be fully conversant with relevant fundraising regulator legislation and guidelines. Maintain awareness of industry trends and best practice, with a view to use these to benefit CALM. Be a data steward for fundraising, ensuring quality data management. When required, be an active and engaged member of CALM’s EDI Supergroup. Understand and adhere to the CALM values. Competencies A demonstrable track record of delivering significant financial results against agreed targets and timescales. Excellent relationship management skills, with ability to engage effectively with a range of audiences, especially with influential and senior people, both internal and external. Ability to direct client facing meetings, getting to the core of what motivates a partner to take action, and present a case for support convincingly. Confidence in managing partner expectations and having difficult conversations where necessary, keeping the charity’s best interests at heart. Excellent verbal and written communication skills, with a keen eye for detail and the ability to develop tailored and compelling presentations, reports and communications to a high standard. Proven ability to prioritise and manage a varied workload, taking initiative and often working to conflicting deadlines. Ability to collaborate and positively contribute to team culture. Willingness to work hard and attend, where necessary, commitments outside of office hours. Passion for the cause and delivering CALM’s mission. Experience 5-7 years experience of successfully managing multi-layered, five or six figure corporate partnerships, ideally within the third sector - from the onboarding of a partnership to delivering exit strategies. Experience of growing and extending partnerships in line with organisational objectives. Experience of being part of a new business process whether that’s attending meetings, pitches or staff votes. Experience of working in a fast paced environment with conflicting priorities and deadlines. Reports to: Corporate Fundraising Lead Contract: Permanent Benefits: Unlimited annual leave, Healthcare cash plan, 6% pension contribution, therapeutic services (after completion of probation), hybrid working & nine day fortnight. Based: London Waterloo twice a week (Wednesdays and Thursdays) / Remote Working (Mon, Tues & Fri), 9.30am - 5.30pm. Salary: £35,000 - £42,000 per annum A work environment that values creativity, personal growth and collaboration.

Calling all Foodies! A very exciting and boutique style food service business who is not the large corporate beast… is looking for a Business Development Manager/ Area Sales Manager/ Field Sales Manager to cover the Guilford and Twickenham postcode area, GU & TW. This brand is like a family, they work with some of the most amazing brands offering Chilled, Ambient, Frozen, drinks, Confectionery, Fresh produce and meat. They work selling into sectors like Hospitality, Schools, Care homes, Workplaces and Leisure. We are looking for a fantastic salesperson to join this amazing team. This role has come about due to growth. Salary: £35k-£40k OTE £60K Long service Awards and Incentives Access to Discounted food Company Car You will be working from home and visting the office only for team meetings. What will you be doing? *60% New Business 40% Account Management *You will be looking after a large list of existing accounts with a 2million pound *You will be selling the whole sale products as well as doing your own lead generation *You will be popping into the companies, cold calling and using Linkedin to get on New Business as well as maintaining your existing customers This business is very innovative; they even have an online platform and an app for wholesale foods to make it easier for your clients! If you are in the GU/TW postcode area, then do apply! This is a brilliant business that really look after their people without being part of a corporate beast with red tape & micromanagement! Mandeville is acting as an Employment Agency in relation to this vacancy.

?? Sales Role | IT Solutions Provider | Hybrid | Flexible Pay Based on GP | Remote ?? ?? ?? ?? ?? ?? An established and growing IT solutions provider is looking for an experienced and driven Sales Executive / BDM / Account Manager to join their team in a hybrid role based near the Midlands. This role isn’t just about hitting KPIs it’s about building long-term relationships, understanding what businesses really need, and delivering tailored IT solutions that make a difference. They support a wide range of clients, from SME's to large corporate accounts, acting as an extension of their IT teams. ?? The Role: -Identify and engage potential clients -Understand individual business needs and provide tailored IT solutions -Manage relationships and help existing clients grow with upgraded or additional services ?? The Package: -Salary is flexible and based on current gross profit performance -Ideally, candidates will be billing around £20k+ GP/month -Hybrid working: just one office day per month for team connection and collaboration -9-5 hours with flexibility and support, no micromanagement -Incredible commission structure ? Who This Is For: -You must have experience in an IT solutions provider, this is non-negotiable -You’re confident, consultative, and used to closing high-value B2B deals -You understand infrastructure, cloud, networking, and cybersecurity offerings This is a brilliant opportunity to join a high-performing, down-to-earth team where your experience is respected, your success is rewarded, and you're given the space to grow your desk the right way.?? Sales Role | IT Solutions Provider | Hybrid | Flexible Pay Based on GP | Remote ?? ?? ?? ?? ?? ?? An established and growing IT solutions provider is looking for an experienced and driven Sales Executive / BDM / Account Manager to join their team in a hybrid role based near the Midlands. This role isn’t just about hitting KPIs it’s about building long-term relationships, understanding what businesses really need, and delivering tailored IT solutions that make a difference. They support a wide range of clients, from SME's to large corporate accounts, acting as an extension of their IT teams. ?? The Role: -Identify and engage potential clients -Understand individual business needs and provide tailored IT solutions -Manage relationships and help existing clients grow with upgraded or additional services ?? The Package: -Salary is flexible and based on current gross profit performance -Ideally, candidates will be billing around £20k+ GP/month -Hybrid working: just one office day per month for team connection and collaboration -9-5 hours with flexibility and support, no micromanagement -Incredible commission structure ? Who This Is For: -You must have experience in an IT solutions provider, this is non-negotiable -You’re confident, consultative, and used to closing high-value B2B deals -You understand infrastructure, cloud, networking, and cybersecurity offerings This is a brilliant opportunity to join a high-performing, down-to-earth team where your experience is respected, your success is rewarded, and you're given the space to grow your desk the right way.

Work with Us. Change the World. At AECOM, we’re delivering a better world. Whether improving your commute, keeping the lights on, providing access to clean water, or transforming skylines, our work helps people and communities thrive. We are the world’s trusted infrastructure consulting firm, partnering with clients to solve the world’s most complex challenges and build legacies for future generations. There has never been a better time to be at AECOM. With accelerating infrastructure investment worldwide, our services are in great demand. We invite you to bring your bold ideas and big dreams and become part of a global team of nearly 50,000 planners, designers, engineers, scientists, digital innovators, program and construction managers and other professionals delivering projects that create a positive and tangible impact around the world. The Water Business prides itself on developing innovative techniques to improve the delivery, efficiency, and sustainable outcomes of our projects. We provide a broad range of clients with a full range of Water services across all sectors. This is a fantastic opportunity to join a Water team of over 700 professionals spread across the UK & Ireland. We’re one global team driven by our common purpose to deliver a better world. Join us. Start here. Grow here. The Director of Growth & Business Development will play a pivotal role in supporting the growth of AECOM’s Water business across the UK and Ireland. This includes identifying new market opportunities, nurturing strategic partnerships, guiding market entry initiatives, and helping steer the business towards sustainable and profitable expansion. The role requires industry knowledge, commercial insight, and collaborative leadership to shape the organisation’s long-term success within the evolving water landscape. This externally focused, high-impact role is essential in shaping market strategy, building strong partnerships, and positioning AECOM as the trusted partner of choice across the water sector. You will collaborate across business lines and geographies, embracing our One AECOM approach to unlock new opportunities and deliver sustainable, long-term value for clients. You will be responsible for coordinating end-market work-winning activities and supporting strategic initiatives across the Water Business Line. A key part of your role will be ensuring effective positioning through branding, marketing, and bidding efforts. With a strong external focus, you will work across AECOM’s global network to connect emerging market opportunities with our technical capabilities. Partnering with regional growth and strategy teams, subject matter experts, and client account leads, you will contribute to shaping successful strategies for priority pursuits. Your work will draw on client insight, market trends, and investment planning to expand our market presence and impact. You will also help refine our go-to-market approach to ensure AECOM remains a forward-thinking and reliable partner to clients. Strategic Growth Leadership • Lead the UK&I Water Business and collaborate with other business lines and sector leads on key pursuits and growth initiatives., • Direct our Client Account Managers and Framework Managers in meeting our clients needs., • Define and execute a growth strategy aligned with corporate goals, while monitoring market trends, policy shifts, and emerging opportunities to guide investment and innovation. Business Development & Sales • Drive new business opportunities and expand the client base through engagement with public and private sectors, partnerships, and networking., • Lead major bids, proposals, and commercial negotiations, ensuring strong win rates and profitability., • Represent AECOM at industry forums and manage joint ventures and framework agreements. Market Intelligence & Positioning • Conduct market and competitive analysis to refine propositions and identify new revenue streams., • Position AECOM as a thought leader in water resilience, digital water, ESG, and infrastructure innovation. Cross-Functional Collaboration & Bid Development • Work closely with marketing, and sector leads to align client solutions with capabilities and market directions., • Foster internal relationships that promote a culture of success., • Coordinate pipeline analysis and bid management to meet business plan targets. Ready to push the limits of what’s possible? Here’s what we’re looking for: • Extensive experience in business development, growth strategy, or commercial leadership, with a proven record in revenue generation, deal structuring, and leading complex bids in the water sector., • Strong knowledge of the water market, including regulatory frameworks, infrastructure cycles (AMP), and digital transformation., • Well-established network in water utilities, infrastructure, or technology sectors., • Experience with public sector procurement and framework agreements., • Excellent communication, and collaboration skills., • Proven ability to drive strategic plans and work across multidisciplinary teams., • Solid understanding of ESG principles in a water context., • Awareness of industry trends in Europe and India. We celebrate diversity, including neurodiversity, and believe it enriches our team. We welcome applications from all backgrounds and abilities. If you are an applicant with a disability that requires reasonable accommodation to complete the application process, please contact us at _. At AECOM, we value everyone's unique contributions and perspectives. If you meet some of the requirements above or have transferable skills you believe would benefit us, we would be delighted to hear from you! Interested in the role or curious about life at AECOM? Follow us on LinkedIn, Facebook, Instagram, and YouTube to explore our AECOM voices, employee stories, latest projects, and much more! For further information about the role, reach out to the recruiter on LinkedIn. About AECOM AECOM is the world’s trusted infrastructure consulting firm, delivering professional services throughout the project lifecycle – from advisory, planning, design and engineering to program and construction management. On projects spanning transportation, buildings, water, new energy and the environment, our public- and private-sector clients trust us to solve their most complex challenges. Our teams are driven by a common purpose to deliver a better world through our unrivaled technical and digital expertise, a culture of equity, diversity and inclusion, and a commitment to environmental, social and governance priorities. AECOM is a Fortune 500 firm and its Professional Services business had revenue of $14.4 billion in fiscal year 2023. See how we are delivering sustainable legacies for generations to come at aecom.com and @AECOM. Freedom to Grow in a World of Opportunity You will have the flexibility you need to do your best work with hybrid work options. Whether you’re working from an AECOM office, remote location or at a client site, you will be working in a dynamic environment where your integrity, entrepreneurial spirit and pioneering mindset are championed. You will help us foster a safe and respectful workplace, where we invite everyone to bring their whole selves to work using their unique talents, backgrounds and expertise to create transformational outcomes for our clients. AECOM provides a wide array of compensation, benefits and well-being programs to meet the diverse needs of our employees and their families. We’re the world’s trusted global infrastructure firm, and we’re in this together – your growth and success are ours too. Join us, and you’ll get all the benefits of being a part of a global, publicly traded firm – access to industry-leading technology and thinking and transformational work with big impact and work flexibility. As an Equal Opportunity Employer, we believe in each person’s potential, and we’ll help you reach yours. We are a Disability Confident Employer and will offer an interview to applicants who have a disability or long-term condition, who meet the minimum/essential criteria for the role. Please let us know using this email address _ if you would like to apply through the Disability Confident Interview Scheme. All your information will be kept confidential according to EEO guidelines.

Experian is a global data and technology company, powering opportunities for people and businesses around the world. We help to redefine lending practices, uncover and prevent fraud, simplify healthcare, create marketing solutions, and gain deeper insights into the automotive market, all using our unique combination of data, analytics and software. We also assist millions of people to accomplish their financial goals and help them save time and money. We operate across a range of markets, from financial services to healthcare, automotive, agribusiness, insurance, and many more industry segments. We invest in people and new advanced technologies to unlock the power of data. As a FTSE 100 Index company listed on the London Stock Exchange (EXPN), we have a team of 22,500 people across 32 countries. Our corporate headquarters are in Dublin, Ireland. Learn more at experianplc.com. We are looking for an experienced and strategic Developer Certification Programme Director to lead the delivery of our global developer enablement initiative for the Ascend Technology Platform. This role is critical to expanding our ecosystem by empowering partner developers to build solutions on the Ascend platform. You will shape the end-to-end certification strategy and platform enablement requirements —defining skill standards, creating learning paths, collaborating on developer tooling, and ensuring the smooth access to knowledge, support, and validation, and driving requirements into our platform and product teams to ensure that the primary technology components are ready for our "open-developer" strategy. This is a remote UK-based position reporting to the SVP Platform & Digital Main Responsibilities • Programme Ownership: Define and lead the global Ascend Developer Certification Programme, ensuring it aligns with platform capabilities, partner needs, and strategic goals., • Partner Enablement: Design and implement learning paths, in partnership with the L&D team, hands-on training, and support tools that allow partner developers to build, test, and launch solutions on the Ascend platform., • Certification Framework: Develop role-based certifications and technical assessments that validate partner developer skills., • Content Development: Oversee the creation of technical content, including curriculum, tutorials, documentation, and exam materials, in partnership with our teams and external experts., • Community & Evangelism: Cultivate a vibrant developer community through forums, events, and direct engagement. Be a promoter for developer experience across the partner ecosystem., • Leadership: Work with Product, Engineering, Customer Success, Marketing, and Partner Management teams to align certification efforts with platform evolution and partner strategy., • Technology enablement: Work with Product and Engineering to ensure that the technical proposition for partner developers meets industry expectations, whilst maintaining the highest standards of control and quality for Experian and its clients, • Metrics & Iteration: Define success metrics and evaluate programme effectiveness to improve engagement and effect., • Platform Advocacy: Serve as the voice of the partner developer—providing feedback to improve APIs, SDKs, documentation, and support services., • Experience in technical change management, transformation programs and delivery in the context of large-scale, mission-critical platforms, • Experience with software development workflows, tools, and platforms (APIs, SDKs, CI/CD)., • Experience working with external partners, ISVs, or developer communities to build partner ecosystem propositions & create value for the enterprise, • Technically fluent, with delivery experience across change and run, whilst also commercially aware, • Talent for translating technical concepts into relevant learning experiences., • Familiarity with LMS platforms, certification tools, and content development best practices. Why Join Us? • Be an important driver of ecosystem growth for a transformative technology platform., • Empower thousands of developers to create value through your programme., • Work with some of the brightest minds in platform engineering, education, and partner success., • Join a mission-driven company committed to developer success, partner collaboration, and long-term platform impact Benefits include:- • Flexible work environment, working hybrid or in the office if you prefer., • Great compensation package and discretionary bonus plan, • Core benefits include pension, bupa healthcare, sharesave scheme and more, • 25 days annual leave with 8 bank holidays and 3 volunteering days. You can purchase additional annual leave. Experian is proud to be an Equal Opportunity and Affirmative Action employer. Innovation is an important part of Experian's DNA and practices, and our diverse workforce drives our success. Everyone can succeed at Experian and bring their whole self to work, irrespective of their gender, ethnicity, religion, colour, sexuality, physical ability or age. If you have a disability or special need that requires accommodation, please let us know at the earliest opportunity. Experian Careers - Creating a better tomorrow together _

The Client Relationship Manager role assists the GPFS International team in servicing our clients. Responsibilities consist primarily of assisting the team with their performance of all Administration activities across multiple entities (including internal GPFS entities). Administration tasks may include capital activity and distribution-related work, review of financial transactions for Private Equity clients and liaising with clients and investors. This position will require regular interaction with team members and clients. Location: Southampton, UK Job Type: Full-time Essential Functions Overall • Improving processes and procedures with the goal of standardizing workflows., • Extensive communication with fund teams about the timing of workflow., • Coordinating with operations directors for new workflow software initiatives., • Ensuring service levels are to the highest standards and ensure deliverables are accurate and on time., • Managing personal time management and maintaining ability to recognize priorities in an ever-changing business., • Leading and participating in special projects as assigned., • Developing and fostering client relationships. Includes establishment of client’s confidence in ability to execute. Admin Focus • Responsible for all administration activities across a select number of client funds and entities including but not limited to investor requests, CRM & Investor Portals, Treasury, calls and distributions., • Supporting client communications and helping to manage client expectations around capital activity., • Participating and providing timing of client capital activity at team meeting., • Supporting client communications and helping manage client expectations., • Participating in client planning meetings., • Onboarding new funds and investors and ensuring proper documentation is received and is complete., • Maintaining client contact database, including ensuring the proper and timely entering and updating of investor information into the CRM portal., • Assessing and monitoring the risk profiles of investors, reviewing CDD documentation and performing sanctions screenings., • Attending all compulsory training as required by the regulations, e.g. AML/CFT periodic training., • Ensuring all operational activities are executed in line with the company’s regulatory responsibilities., • Complete any related client ad hoc projects. Company Secretary Focus • Assisting with the Company Secretarial function, as required., • Assisting with Company Secretarial functions including board packs, meetings, minutes and filings, both in Guernsey and in the UK., • Assisting with client on-boarding processes in relation to Company Secretarial and Administration requirements., • Contribute to client wide decision-making processes over key issues, • Assist in managing internal and external (eg NED) diaries. Competencies • Organized, • Detailed Oriented, • Results Driven, • Works Collaboratively Work Environment This job operates in a modern professional office environment, requiring both in office and remote work. This role routinely uses standard office equipment such as computers, phones, and photocopiers. Physical Demands The physical demands described here are representative of those that must be met by an employee to successfully perform the essential functions of this job. While performing the duties of this job, the employee is regularly required to talk and hear. The employee frequently is required to stand; walk; use hands to finger, handle or feel; and reach with hands and arms. Required Education and Experience • CGI (Chartered Governance Institute) qualified or part qualified, or other related program, • 3 or more years of experience in funds administration, • Experience in Company Secretarial and Governance services, • Neat, organized, strong attention to detail, and able to work independently and interdependently, • Strong communication skills, with the ability to work with stakeholders at all levels (including C-Suite) and in various locations around the world, • Strong knowledge of fund industry Preferred Education and Experience • Bachelor’s degree in accounting, finance, law, or business administration is desirable, or alternatively, a master’s degree in above mentioned fields, • 3 or more years of experience in private equity, • Supervisory experience, • Experience working with Diligent, Board Intelligence, Board Logic, GEMS, or other related Co Sec software packages, • Experience working for a company within multiple countries / jurisdictions Additional Eligibility Qualifications • Excellent people skills, with an ability to partner with a dynamic team., • Personal qualities of integrity, credibility, and commitment to corporate mission., • Flexible and able to multitask; ability to work within an ambiguous, fast-moving environment. Other Duties This role will be part of a fast-growing small business that from time to time may require hands-on help within the various jurisdictions. GPFS Vision Our purpose is to create enduring relationships with our employees and clients by consistently delivering exceptional opportunities and service. GPFS Value Statement Investing in people and culture. Core Values Camaraderie: Being supportive of one another and celebrating each other’s successes. Excellence: Consistently delivering exceptional work and going above and beyond. Empowerment: Fostering a deep sense of agency and ownership over one’s choices and actions. Innovation: The drive to think differently and solve problems creatively. Inclusion: Recognizing individual’s unique strengths and perspectives with mutual trust and respect. #LI-GP1

Mostly remote requiring 1-4 days per month in the office. Excellent opportunity for an experienced EA to support the CEO and CFO of a medium sized corporate firm, remote-based with 1-4 days per month in the office.

Veeva Systems is a mission-driven organization and pioneer in industry cloud, helping life sciences companies bring therapies to patients faster. As one of the fastest-growing SaaS companies in history, we surpassed $2B in revenue in our last fiscal year with extensive growth potential ahead. At the heart of Veeva are our values: Do the Right Thing, Customer Success, Employee Success, and Speed. We're not just any public company – we made history in 2021 by becoming a _ (PBC), legally bound to balancing the interests of customers, employees, society, and investors. As a _ company, we support your flexibility to work from home or in the office, so you can thrive in your ideal environment. Join us in _, committed to making a positive impact on its customers, employees, and communities. The Role This role is ideal if you are looking to build a career with a company that has track record of success and excellent corporate culture grounded in our values – Do the Right Thing, Employee Success, Customer Success and Speed. If you are driven to provide an excellent customer experience and work with software, this job is for you! \n What You'll Do • Advise end users on best practices when using Veeva’s applications, • Identify and resolve client issues associated with Veeva’s applications, • Build strong and professional relationships with all users of Veeva’s applications, • Provide recommendations/feedback on client service improvements and product development, • Maintain the highest standards of customer service, quality, and professionalism with customers and coworkers, • Maintain accurate records of all email/telephone/chat correspondence related to the role Requirements • 1+ years relevant experience in a customer service role, • Effective communication, organizational, and time management skills, • Professional telephone manner, • Demonstrated competence in standard computer packages (Word, Excel, PowerPoint), • Excellent verbal and written communication skills in English and secondary European language will be required., • Ability to quickly understand client requirements and needs and articulate potential solutions Perks & Benefits • Allocations for continuous learning & development, • Private Health Insurance \n #LI-Remote Veeva’s headquarters is located in the San Francisco Bay Area with offices in more than 15 countries around the world. As an equal opportunity employer, Veeva is committed to fostering a culture of inclusion and growing a diverse workforce. Diversity makes us stronger. It comes in many forms. Gender, race, ethnicity, religion, politics, sexual orientation, age, disability and life experience shape us all into unique individuals. We value people for the individuals they are and the contributions they can bring to our teams. If you need assistance or accommodation due to a disability or special need when applying for a role or in our recruitment process, please contact us at _.

We are seeking a Clinical Customer Success Executive with a strong clinical and corporate background to join our team. This role leverages your medical expertise to drive client satisfaction and successful adoption of Hippocratic AI’s solutions. This role will partner with and report to the Chief Medical Officer. While this is a remote role, it requires regular travel (up to 5 days a week) to client locations in London and regular in-office collaboration in Palo Alto, CA. Responsibilities: Build and maintain strong relationships with healthcare executives and clinical leadership, serving as a trusted medical advisor. Lead end-to-end product implementations, ensuring alignment with physician workflows and clinical decision-making processes. Provide clinical expertise to inform strategic decisions, particularly in areas such as diagnostic support and patient outcomes. Train clinical leaders on the use of Hippocratic AI solutions to address complex medical scenarios. Identify and advocate for advanced clinical use cases of AI technology to enhance care delivery and improve operational outcomes. Collaborate with internal teams (sales, product, engineering) to translate client feedback into impactful product enhancements. Define and track success metrics, including clinical outcome improvements, adoption rates, and operational efficiencies. Travel extensively to client sites to engage with physician teams and participate in in-office strategy discussions in Palo Alto. Qualifications Must-Have: Active Medical Doctor (MD) license 5 years minimum of clinical experience Proven success in customer-facing roles, such as customer success, account management, or healthcare leadership. Strong background in project management. Strong communication and leadership skills. Ability to travel extensively Preferred: Experience with AI or technology integration in healthcare. Advanced understanding of healthcare workflows, compliance, and clinical outcomes. 3+ years in corporate or health technology roles

About Tailscale Tailscale is building the new Internet by delivering software that makes it easy to securely interconnect people and their devices, no matter where they are. From hobbyists to multinational corporations, teams of every size use Tailscale each day to protect their networks, share access to internal tools, and more. We're building a future for the Internet that's easy, sensible, and safe, like it used to be. Founded in 2019 and fully distributed, we're backed by Accel, CRV, Insight, Heavybit, and Uncork Capital. Job Description Join our rapidly growing Sales team where you will play an important role at one of the fastest growing companies in the Developer Security space. As a Customer Account Executive, you will be responsible for helping expand and renew current customer accounts. You will focus on finding additional use cases, educating the client base on new feature releases, and ensuring the successful adoption of Tailscale across all of your existing customer accounts. You will partner closely with the Solutions Engineering team, as well as collaborate with the Customer Success, Support, Marketing, and Product teams. We're an energetic company with a wide variety of backgrounds. We coach each other, share feedback, and collaborate to maximize our performance and earning potential, all the while aligning with our customers' needs. Key Responsibilities • Build a credible pipeline every quarter by engaging with clients on upsells and renewals, • Own an upsell and renewal number across your accounts, • Help educate customers on the value of Tailscale throughout the evaluation & adoption cycle, • Generate short-term results while maintaining annual pipeline coverage, • Provide accurate weekly forecasting & revenue delivery, • Create mutual action/success plans with prospective and existing customers where appropriate to help them evaluate and expand their usage of the Tailscale product What We Are Looking For • 2+ years of closing experience in an AE or an AM role, • A strong desire to join a high-growth software startup in a fully remote role, • Has sold developer and/or technical products, especially in a product-led growth (PLG) motion, • Experience presenting to senior managers and executives, • The ability to manage many opportunities simultaneously at various stages, coupled with a strong track record of meeting and exceeding quota, • Experience using Gong, or similar, to collaborate internally and manage pipeline, • Experience partnering with a Sales Engineering team, support, and customer success team to drive positive outcomes for clients, • Must be located in London to be considered. The team coworks at a WeWork 2 days a week. As a company, we strive to maintain fair and equitable compensation practices within our team across all roles and all levels. Tailscale's compensation package includes base salary, equity, and comprehensive benefits. The salary range displayed on each job posting represents the target range for a new hire's base salary. Individual offers may vary based on experience and skill set. For this position, our pay ranges reflect target OTE (on target earnings), inclusive of base salary and variable compensation tied to the attainment of quarterly sales targets. UK Pay Range (OTE)£98,750—£118,500 GBP Frequently cited statistics show that people who identify with historically marginalized groups are likely to apply to jobs only if they meet 100% of the qualifications. We encourage you to help us break that statistic! What We Offer • An inclusive, flexible environment where you can be your authentic self. We recognize the impact of diverse voices and backgrounds on the growth of our people, product, and company. And that flexibility in how and when you work empowers our team to integrate work and life., • A competitive total compensation package. This includes a base salary, an equity incentive plan and variable commission (for quota-based roles)., • Comprehensive group benefits with no waiting period. Take advantage of coverage for health, vision, dental, and more for you and your family!, • All-remote with the opportunity to work from anywhere—enjoy a change of scenery wherever you can get wifi, participate in virtual and in-person social events, and leverage our corporate co-working program to visit WeWork (or other similar spaces near you)., • Connect with other Tailscalars IRL. Attend our annual company retreat, participate in team/department off-sites, or use your individual travel budget to meet up with team members in Canada, the US, or the UK., • Support for your personal and professional development. Grow your career thoughtfully with $1500 USD annually for professional development, or take advantage of mentorship, coaching, and internal promotion opportunities., • Paid time off and a healthy work-life integration. Our flexible, paid time off program supports you for any situation life throws your way, whether moving homes or travelling the world!, • A build-your-own home office setup. You choose your own company-owned laptop (Mac or PC), receive a monthly home internet reimbursement, and $1000 USD to customize your workstation to make it your own., • Generous parental leave program from your first day. We care about your life outside of work and encourage new parents to take advantage of parental leave top-ups for up to 26 weeks. Please be aware that legitimate emails from Tailscale's talent team will only originate from @tailscale.com, @greenhouse.io, and @interviews.modernloop.io email addresses. For more information about protecting yourself from impersonators and scams, please visit _.

Benefits of working at Together • 26 days holiday, and a day off for your birthday (increasing with service to 30 days), plus bank holidays, • Free access to company holiday homes, • Buy & sell holidays, • Discretionary annual bonus plus an additional Shared Reward Bonus, • Matched pension contribution, • Health cash plan plus Private medical insurance, • Life assurance and Critical illness cover, • Travel season ticket loans and Ride to work scheme, • Free local gym access, • Local bar / restaurant discounts Company Description We’re Together. For over 50 years, we’ve helped thousands of people, businesses and professionals unlock their property ambitions with our common-sense approach to mortgages and secured loans. We take the time to understand our customers and our door is always open, so we can often help when other lenders can’t or won’t. Based in Cheadle, Cheshire, our 750 colleagues help our customers throughout the UK, backed by the power of a £7 billion loan book. As a Mortgage Telephone Business Development Manager you will be responsible for exceeding sales targets and new business generation KPIs to meet with business objectives by developing opportunities. You will understand different partners’ business models, driving performance and quality of business submitted by allocated intermediary packager partners. The above will be articulated in a territory plan with specific account plans for key accounts. You will be supporting the channel in developing strategies to optimise potential within the market and taking an active role in sales meetings and discussions to increase the Together reach into the market. You will also be managing existing relationships and performance using appropriate lines of communication and management information tools. You will present the Together products and services positively and professionally, both via MS Teams, email, telephone and sometimes face to face, to educate and grow our market share. Time will be split between working remotely (c.75%) and visiting packager partners in the field (c.25%). Whilst working in the field, it is anticipated that this role will require flexibility for some overnight stays. The split between remote and field time may vary according to the businesses requirements. You will expertly represent and train out the underwriting / packaging requirements of the company (both CF & PF in-line with our One Together approach) and provide competitor insight by understanding and collating relevant market intelligence and concisely feeding this back in to the business. Additionally you will assess new partner opportunities for packaging, or where a referral to another channel in the business maybe more appropriate (e.g. Banking / corporate) or facilitating introductions to existing panel packager partners. As a Mortgage Telephone Business Development Manager we are looking for someone to: • Identify and target new intermediary partners across defined regions and segments to drive business growth., • Develop and execute proactive business development strategies to penetrate new markets and expand distribution., • Generate pipeline through outbound activity, F2F meeting, networking, event and broker engagement., • Deliver training tailored to the needs of potential partners, demonstrating the USP’s and flexibility of Together in all products., • Manage the funding cycle from enquiry to submission whilst tracking pipeline conversion to ensure strong fundings., • Manage, nurture and develop existing relationships to develop potential, • Ensure territory coverage is wide and aligned to maintain and improve underserved regions, new firms and segments, • Conduct market research to identify gaps and opportunities whilst analysing trends to anticipate demand and awareness as to where the business can gain competitive advantage., • Feedback competitor and market intel to inform and influence products and marketing, • Attend trade shows, expo’s, networking events to raise brand profile, • Accurately log all information into CRM ensuring visibility and accountability for data., • Maintain high quality MI and territory planning clearly demonstrating tactical activity, • Work closely with internal teams to meet the needs of intermediaries, • Consistently exceed new business targets ( eg new broker registrations, training sessions etc ), • Act as ambassador for the business ensuring the brand is presented with consistency and professionalism, • Effective diary management to ensure all intermediaries visits are aligned to contact strategies using 100/60/40 technique and zoning, • Ensure compliance with internal procedures and risk frameworks, acting as a first line to risk., • Understand and demonstrate first line risk, understand the RCSA and be able to articulate these whilst promoting fraud avoidance, • Continuously look at ways to improve account satisfaction, operational efficiency and intermediary experience, • Maintain an accurate working knowledge of the Group’s current product criteria & underwriting procedures, • Ensure that all non-financial objectives (SLA’S, broker accreditation) & behaviour & competency framework measures (activity, capacity etc) are achieved. Essential: • Proven track record in business development within specialist Mortgage lending – specifically within the southern/London region, • Ability to develop a robust contact strategy with differing accounts, • Strong commercial awareness, • The ability to work to targets and deadlines, • The ability to work collaboratively, with ability to help influence change, • Exceptional interpersonal, influencing and negotiation skills, • Effective pipeline and diary management skills, • Exceptional communication skills with the ability to converse with all levels of seniority, • PC skills including Microsoft Office, • An assertive and tactful manner, • Strong objection handling and problem solving skills, • Full driving license, • Excellent time management skills and the ability to work to achieve KPIs If you feel you have some of the skills mentioned above, but not all, please do still apply and we would be happy to have a further discussion with you in regards to your suitability for the role. Together embraces diversity and inclusion, and are proud to be an equal opportunity workplace. Not only do we welcome difference – we celebrate it, support it and really value our colleagues for who they are. We are committed to building a team that represents a variety of backgrounds, perspectives and skills. If you feel you'd benefit from any support or reasonable adjustments during any stage of the recruitment process, please don’t hesitate to let us know when completing your application. This information will be picked up by our team, so we can try and put steps in place to help you be at your best through this process. Click here for more information on our _ Please note that all successful applicants will undergo relevant employment reference, financial and criminal record checks.

Assent is the leading solution for supply chain sustainability tailored for the world’s top-tier, sustainability-driven manufacturers. Hidden risks riddle supply chains, many of which weren't built with sustainability in mind. That's where we step in. With insights from experts, Assent is the tool manufacturers trust for comprehensive sustainability. We are proud to announce that Assent has crossed the US$100M ARR milestone, granting us Centaur Status. This accomplishment, reached just 8 years following our Series A, makes us the first and only Certified B Corporation in North America's SaaS sustainability industry to celebrate this milestone. Our journey from $5 million to US$100M ARR in just eight years has been marked by significant growth and achievements. With our $350 million US funding led by Vista Equity Partners, we're poised for even greater expansion and are on the lookout for outstanding team members to join our mission. Hybrid Work Model At Assent, we proudly embrace a remote-first work model, valuing the flexibility and autonomy it provides our team. We also acknowledge the intangible benefits of occasional in-person workdays. For team members situated within 50 kms/31 miles of our five global offices in Ottawa, Eldoret, Penang, Columbus, and Amsterdam, you can expect to come into the office one day a week. Similarly, those near our co-working spaces in Nairobi and Toronto are encouraged to work onsite once a month. Join our _ to stay in touch and learn more! Reporting to the Manager, Business Development, the Business Development Representative directly impacts Assent’s growth by fueling our go-to-market engine, engaging top compliance leaders, and generating quality pipeline for the business. In this role, you will focus on methodically prospecting into our target audience, strategically engaging our ideal buyers through tailored messaging, and setting qualified meetings and opportunities that consistently convert into annual recurring revenue. Key Requirements & Responsibilities • Leverage all available marketing resources and advanced sales development tactics in order to generate highly qualified meetings from target accounts within relevant industries, • Drive net new and expansion pipeline growth by scheduling qualified meetings, • Identify and engage with ideal prospects from target accounts, • Execute our GTM strategy through methodical and targeted messaging, • Deliver tailored messaging for emails, social messages, engaging videos, and phone conversations, • Optimize utilization of tech stack and internal resources, • Follow prescribed workflows, processes, and ROEs, • Complete daily outreach tasks efficiently and effectively across a variety of channels, • Qualify and manage inbound lead flow for allocated accounts, • Meet/ Exceed monthly targets, • Expand on knowledge and skills by absorbing best practices and staying current on Assent’s product knowledge, industry trends, and competitive intel, • Engage in onboarding, reinforcement, and advanced training as you move up through the BDR Level Program, • Participate in weekly meetings and articulate market feedback, • Follow guidance set out by corporate security policies and standards, • Ensure departmental security processes and procedures are followed where applicable, • Be familiar with corporate security policies and follow the guidance set out by processes and procedures of Assent. We strongly value your talent, energy and passion. It will also be valuable to Assent if you have the following qualifications: • Native German Speaker and fluency in English (verbal and written), • You have a strong work ethic- you are self-motivated, dedicated, and committed to high performance in your role, • Excellent time management and organizational skills - ability to manage a multitude of tasks efficiently and effectively, • You are highly adaptable, flexible and thrive in a fast-paced, ever-changing environment;, • You are a critical thinker- always striving to methodically think through solutions and improve, • You have an insatiable thirst for knowledge - you consider yourself a lifelong learner, • You are conscientious, resilient, and dedicated to achieving excellence and driving results, • You are coachable, open to feedback, and always striving to self-improve At Assent, we are uniquely positioned to make meaningful, impactful changes in the world around us. If you believe in doing work that matters, we want you to join our team. Life at Assent Wellness: We believe that you and your family’s well being is important. As a result, we offer vacation time that increases with tenure, comprehensive benefits packages (details vary by country), life leave days and more. Financial Benefits: It’s not all about the money – well, it’s a little about the money. We understand that financial health is important and we offer a competitive base salary, a corporate bonus program, retirement savings options and more. Life at Assent: There is purpose beyond your work. We provide our team members with flexible work options, volunteer days and opportunities to get involved in corporate giving initiatives. Lifelong Learning: At Assent, curiosity is not only valued but encouraged. You will receive professional development days that are available to you the day you start. At Assent, we are committed to growing and sustaining an environment where our team members feel included, valued, and heard. Our diversity and equal opportunity practices are guided and championed by our Diversity and Inclusion Working Group and our Employee Resource Groups (ERGs). Our commitment to diversity, equity and inclusion includes recruiting and retaining team members from diverse backgrounds and experiences, and fostering a culture of belonging where all team members are included, treated with dignity and respect, promoted on their merits, and placed in positions to contribute to business success. If you require assistance or accommodation throughout any part of the interview and selection process, please contact _ and we will be happy to help. We use AI to support parts of our recruitment process, such as note-taking and initial shortlisting based on job-related qualifications. AI does not make hiring decisions. All candidates will speak with a real person, and final decisions are always made by our recruitment team.

Allgemeines Willkommen bei pro clima CH GmbH! Über das Team Klingt das nach Ihrem Erfolgsweg? – Dann werden Sie Teil der pro clima-Familie. Wir sind ein kleines, dynamisches und interkulturelles Team und stehen in engem Kontakt mit den Kollegen in der deutschen Zentrale. Schicken Sie uns online ihre Bewerbung über unsere Homepage zu. Wir freuen uns auf Sie! Selbstverständlich sind Online-Vorstellungsgespräche für uns kein Problem. Sollten Sie noch Fragen haben, können Sie sich gerne an uns in der Zentrale an die Personalabteilung Export wenden: Telefon: +49 62 02 - 27 82 0 pro clima CH GmbH Schweiz - Suisse - Svizzera - Svizra Aufgaben • Verantwortung für die zielorientierte Entwicklung des Vertriebsgebiets, • Persönliche und telefonische Betreuung der Bestandskunden mit hoher Serviceorientierung sowie aktive Pflege von Kundenbeziehungen, • Durchführung von Schulungen vor Ort und gezielte Vermittlung von Fachwissen an Händlerkunden und Verarbeiter, sowohl beim Kunden als auch an unseren Standorten in der Schweiz und Deutschland, • Auf Messen führen Sie Gespräche mit bestehenden Kunden und potenziellen Neukunden, um unser Netzwerk zu erweitern, • Identifizierung von Kunden- und Marktpotenzialen durch kontinuierliche Marktbeobachtung und -analyse sowie Ableitung geeigneter Maßnahmen, • Selbstständige Planung und Organisation Ihrer Kundentermine und regelmäßige Berichterstattung Ihrer Aktivitäten und Erfolge, • Unser Firmenstandort ist Basel, Sie arbeiten jedoch überwiegend im Homeoffice oder sind in der Zentralscheiz Mitte-West unterwegs, um Kunden vor Ort zu beraten und zu schulen, • Die Zeit im Homeoffice nutzen Sie zur strukturierten Planung und Nachbereitung Ihrer Vertriebsaktivitäten Qualifikationen • Erfolgreich abgeschlossene kaufmännische oder technische Ausbildung, ein entsprechendes Studium oder fundierte Kenntnisse im Bereich Holzbau oder Dachdeckerhandwerk. Alternativ sind Sie ein erfahrener Handwerker im holzverarbeitenden Gewerbe, • Einschlägige Berufserfahrung im Außendienst, idealerweise in der Baustoffbranche, • Flexibilität und Mobilität liegt Ihnen, denn Sie arbeiten gerne flexibel, sind viel unterwegs und schätzen die Abwechslung zwischen verschiedenen Standorten und dem Homeoffice, • Außergewöhnliche Kunden- und Serviceorientierung sowie eine ausgeprägte Teamfähigkeit und Kommunikationsstärke, • Sehr gute Office-Kenntnisse und Erfahrung mit CRM-Systemen. Vertrautheit mit modernen Softwarelösungen oder Offenheit für neue Technologien, • Hohes Maß an Organisationsgeschick, Selbstständigkeit und Zuverlässigkeit, • Freude am Aufbau und der Pflege langfristiger Kundenbeziehungen sowie die Überzeugungskraft durch fachliche Kompetenz stehen im Mittelpunkt, • Ein sicheres und kompetentes Auftreten sowie Begeisterung für die Präsentation neuer Lösungen auf der Baustelle und in Schulungen sind vorhanden Benefits • Individuelles Onboarding für einen angenehmen und professionellen Einstieg, • Mittelklasse Firmenwagen zur geschäftlichen sowie privaten Nutzung, • Flache Hierarchien und persönlicher Kontakt zu den Fachbereichen der Firmenzentrale, • Dynamisches und innovatives Team, in das Sie Ihre Ideen einbringen können, • Möglichkeit zum voll flexiblen, mobilen Arbeiten, • Möglichkeiten zur Teilnahme an Schulungen, Workshops und Fortbildungen zur persönlichen und beruflichen Entwicklung, • zusätzliche Urlaubstage, • Corporate Benefits _ Über uns Die Firma MOLL bauökologische Produkte GmbH ist ein mittelständisches Unternehmen mit Sitz in Schwetzingen. Das Unternehmen entwickelt und produziert innovative Bauprodukte für die Dichtung der Gebäudehülle unter der Marke pro clima. Diese Produkte und deren Einsatz tragen zum Schutz der Wärmedämmung, zur Energieeinsparung, zur Vermeidung von Bauschäden, und für die Schaffung von gesünderen Wohn- und Arbeitsräumen mit gutem Wohnraumklima bei. Ein Sektor mit großem Wachstumspotenzial - nicht nur in Deutschland: pro clima exportiert seine Produkte weltweit in über 40 Länder.

Commercial Solicitor Location: Henley-on-Thames Working Pattern: Hybrid typically 3 days in the office and 2 days working from home Salary: From £50K for around 3 years PQE, with flexibility upwards for the right individual About the Firm Our client is a boutique law firm focused on supporting businesses with corporate, commercial, litigation and dispute resolution matters. The firms approach is honest, pragmatic and commercially astute, with a strong emphasis on building long-term client relationships and understanding each clients wider business objectives. We are now looking to appoint a Commercial Solicitor with at least 3 years PQE to support the continued growth of the practice. This will suit a solicitor who is confident handling a broad mix of commercial contracts and corporate transactions, particularly the buying and selling of businesses, and who is comfortable running matters with a good level of autonomy. The role is based in Henley-on-Thames, with hybrid working available. The team is typically in the office 3 days per week, with 2 days from home. The firm would particularly welcome someone who is local to the area and enjoys networking and building relationships within the business community. Key Requirements We are keen to hear from solicitors who can demonstrate: • A minimum of 3 years PQE in company commercial and/or corporate commercial law, • Strong experience in contractual work, including drafting, reviewing and negotiating agreements, • Experience advising on terms of business, terms and conditions, and wider commercial arrangements, • Proven ability to handle business sale and purchase transactions with confidence, • The ability to run files independently and progress matters with minimal supervision, • A commercial, practical and client-focused approach, • Strong drafting, negotiation and communication skills, • An interest in networking and developing relationships within the local business community Please note:Commercial property experience is not required, as the firm has dedicated property lawyers. Role & Responsibilities As a Commercial Solicitor, you will be involved in a broad range of work, including: • Drafting, reviewing and negotiating a wide range of commercial contracts, • Advising on terms of business, terms and conditions, supply agreements, and other trading arrangements, • Running business sale and purchase transactions, • Supporting on acquisitions and disposals, • Advising owner-managed businesses and SME clients on day-to-day commercial and corporate matters, • Drafting and advising on shareholder agreements, joint venture arrangements, and related company documentation where required, • Managing matters with an appropriate level of autonomy, • Building and maintaining strong client relationships, • Taking an active role in networking and business development locally Additional Information • The office is based in Henley-on-Thames, close to the local train station, • Hybrid working is available, with most of the team working in the office 3 days per week Why Join? This is an excellent opportunity to join a well-regarded boutique practice with a clear focus on supporting businesses through pragmatic, commercially sound legal advice. The role offers good quality work, strong client exposure, a sensible degree of flexibility, and the chance to become a visible part of the local business community in Henley-on-Thames. JBRP1_UKTJ

Accountant – Qualified / Qualified by Experience Award winning accountancy practice based in Caterham, Surrey requires an experienced accountant able to lead others in the team with cloud accounting. In this role you will provide a high standard of technical service to clients, ensuring accurate and timely delivery in line with client requirements. You'll also be responsible for: • Working from client provided and in-house done bookkeeping to prepare and complete corporate and small limited company and self employed accounts, • Preparing corporation tax returns (CT600) with appropriate calculations, • Completing self assessment tax returns for individuals and self employed traders, • Assisting in-house bookkeepers with their accounting and software queries especially when needed to correct errors and updating and reconciling ledgers, • Carrying out VAT checks and reviews of bookkeepers work, • Liaising with clients to obtain information to complete above tasks, • Complying with financial laws, regulations and standards alongside in-house policies, • Reporting discrepancies and issues (including potential fraud) to senior management, • Software used includes Xero, Sage (Cloud and 50), Freeagent and QuickBooks. You should also be proficient in Microsoft Office (Outlook, Word and Excel)., • Migrating clients onto cloud bookkeeping including setting up opening balances and integrating any third party apps (eg tills, sales channels, stock control, payment systems etc), • You should be able to demonstrate good communication skills and be able to manage time effectively and efficiently ensuring deadlines are met with excellent accuracy and attention to detail., • Keeping personal accounting qualifications up to date Skills & Experience: • Proven experience in preparing company and self-employed accounts and tax returns, including dealing with HMRC, • Excellent working knowledge of cloud accounting software, preferably Xero (including client onboarding), • Strong Microsoft Office skills, especially Excel, • Excellent communication skills and a polite telephone manner, • High attention to detail and the ability to work effectively under deadlines, • Accountancy practice background preferred Why Join Our Client? • Location: Based in Caterham with the option to work from home one day a week, • Full-time role: Monday to Friday (9 am to 5 pm), • Benefits: 20 days holiday (plus bank holidays and Christmas/New Year closure), • Workplace Pension scheme, • Health Plan This is a fantastic opportunity for an experienced accountant to take on a leadership role and work in a forward-thinking, award-winning practice. If you’re ready to take the next step in your career and lead digital accounting transformations, apply now or contact Kourtney Luckett at TPF Recruitment for more details! We look forward to hearing from you.

Job Title: Senior Geophysicist Location: Office based with approx. 10% fieldwork at sites throughout the UK Salary: Around £50kpa + Company Vehicle + Fuel Card + Credit Card The Opportunity A premier independent geoscience and engineering consultancy is seeking a highly motivated, inquisitive, and thorough Senior Geophysicist to drive technical excellence, conduct research and development of innovative data collection methods and processesand lead high-profile, complex near-surface investigations . Operating at the cutting edge of research and development, this office-based role carries a national and international remit across transport infrastructure, geotechnical engineering, unexploded ordnance (UXO) detection, and environmental sectors. You will act as a pivotal technical lead and subject matter expert, collaborating directly with the executive leadership team to design complex survey solutions and mentor the next generation of geoscience talent. Technical Essentials Qualifications: Postgraduate degree (MSc/PhD) in Geophysics or a closely related geoscience discipline. Experience: Substantialverified hands-on experience in high-resolution, near-surface geophysical investigations, with a proven track record of managing high-value projects from initial proposal design through to final delivery. Methodology Expertise: Advanced proficiency across Ground Penetrating Radar (GPR), Electromagnetics (EM), Magnetometry, Microgravity, Electrical methods (Resistivity, Induced Polarisation), and Seismic methods (P- and S-wave refraction, surface wave analysis). Software Mastery: Expert data processing and interpretation capabilities utilizing Oasis Montaj, GeoGiga, SurfSeis, Res2Dinv, Radan, or Aarhus Workbench. Proficiency in AutoCAD, Microstation, ArcGIS, or QGIS is essential; Python scripting for data automation is highly desirable. Compliance & Delivery: Absolute commitment to rigorous quality assurance frameworks, safety-critical site workflows, and the clear communication of complex technical data to non-technical client stakeholders. Package Position: Permanent, predominantly office-based with occasional UK and international field oversight. Remuneration: Competitive salary structured to reflect senior-tier technical expertise. Benefits: Comprehensive corporate benefits package, dedicated budget for continuous professional development (CPD), and clear progression pathways to executive technical management. Apply Now To discuss this strategic technical appointment in absolute confidence, call Simon Cowley on 07441 449303 TPBN1_UKTJ

Veterinary Surgeon | Up to £80,000 DOE | No OOH | Visa Sponsorship Available Looking for a practice where you're trusted, supported, and genuinely valued? I'm currently recruiting on behalf of a fantastic, independently run small animal practice that's been at the heart of its local community for over 11 years. This is an opportunity to join a well-established team with a loyal client base, an excellent reputation, and the clinical freedom to practise high-quality veterinary medicine. Unlike many corporate environments, this practice benefits from local ownership with full autonomy, meaning decisions are made for the good of the team, patients and clients, not head office targets. Why this opportunity stands out You'll become part of a friendly, collaborative team that genuinely enjoys working together. The practice has built an impressive and varied caseload, allowing you to utilise your skills while continuing to develop professionally. Whether you're passionate about surgery, internal medicine, imaging or another area of practice, your interests will be encouraged, with genuine investment in your ongoing development through funded certificates and dedicated CPD. You'll be working alongside experienced veterinary colleagues, a highly supportive nursing team, welcoming reception staff, and a Practice Manager who is Mental Health First Aid trained, creating an environment where wellbeing is taken seriously. The Role This position would suit an experienced Small Animal Veterinary Surgeon who is confident managing a varied GP caseload. You'll ideally have experience in: Routine and advanced small animal consultations Soft tissue surgery Internal medicine Ultrasound Laboratory result interpretation Building lasting relationships with clients Working collaboratively within a supportive clinical team If you're someone who enjoys delivering excellent patient care while working in a positive, friendly environment, this could be an excellent next step. What's on offer? ? Salary up to £80,000 DOE ? No Out of Hours ? Monthly bonus scheme ? Full Certificate of Sponsorship (Visa) support for overseas applicants ? Dedicated CPD allowance ? Fully funded certificates ? Paid professional memberships ? Pension scheme ? Life Assurance (4x annual salary) ? 28 days annual leave, increasing to 33 days with service ? Free on-site parking ? Retail Hub wellbeing programme with access to professional counselling ? Staff discounts on pet care and products ? Cycle to Work Scheme ? Colleague reward platform with exclusive high street and online discounts Ready for your next move? If you're looking for a practice where clinical standards are high, the team is genuinely supportive, and your career development is actively encouraged, I'd love to tell you more. For a confidential conversation or to apply, contact Lucy today: Lucy Emberton-Leveson Spencer & Co Recruitment Whether you're actively looking or simply curious about the opportunity, get in touch, Id be delighted to discuss the role with you in confidence. JBRP1_UKTJ

HGV CLASS 2 DRIVER Location: Oxford CompetitivePay +OvertimeAvailable Full-Time |Permanent/Contract Looking forsteady, well-paid driving workwith an immediate start? Were hiring experiencedHGV Class 2 Driveron behalf of a leading commercial relocations companyto join a busy and friendly transport team in Oxford. Whether youre looking forongoing workorapermanent role, this is a great opportunity withconsistent hoursandweekly pay. This is an excellent opportunity to join a well-established business delivering professional office and corporate relocation services. The role offers stable work on a flexible basis,regular overtime opportunities, and the chance to work as part of a professional relocation team supporting major corporate clients. If you are an experiencedClass 2 Driverlooking for a varied role beyond standard delivery driving, this could be the perfect opportunity. The Role: As anHGV Class 2 Driver, you will be responsible for the safe transportation of office furniture, IT equipment, and commercial assets between client locations across London. You will also work closely with the relocation teams to support office moves and installations. Key Responsibilities: • DrivingHGVClass2vehiclessafelyandefficiently in and around Oxford., • Transportingofficefurniture,ITequipment,andbusinessassets, • Assistingwithloadingandunloadingvehiclesaspartoftherelocationteam, • Ensuringgoodsaresecuredandprotectedduringtransit, • Carryingoutdailyvehiclechecksanddefectreporting, • Completingdeliverypaperworkandjobdocumentation, • Providingaprofessionalservicewhenworkingonclientsites, • Followinghealth &safetyproceduresandmanualhandlingguidelines WhatWe'reLookingFor: • ValidHGVClass2(CategoryC)licence, • Driver CPC Qualification, • Digital Tachograph Card, • Goodlevelofphysicalfitness(roleinvolvesmanualhandling), • Reliable,professional,andteam-orientedattitude, • Flexibilityforearlystarts What WeOffer: • Competitivesalary, • Flexible,permanentemployment, • Traininganddevelopmentopportunities, • CompanyuniformandPPE, • Opportunitytoworkwithawell-establishedcommercialrelocationspecialist APPLY NOW IfyouareareliableHGVClass2Driverlookingforalong-termopportunitywithafantastic company,wewouldlovetohearfromyou. JBRP1_UKTJ

Global practices and later in London, heavy throughout the disciplines and with a specific corporate footprint in general corporate x2 M&A partners are needed with a demonstrable BD ability and mentality. NEW for a UK corporate partner x2 looking to make the jump / step to a US firm (based in London

As a Corporate – Legal – Office of the Secretary – Assistant Vice President in Legal department you will support the delivery of corporate governance and company secretarial services to the Firm's subsidiaries that operate within EMEA. Part/Fully Qualified Company Secretary, Corporate Governan

Responsibilities : Cleaning office spaces Cleaning toilets Cleaning communal areas such as kitchens Emptying Bins Any other duties as and when required Experience is not necessary as all training will be given, this is a temporary ongoing role that could become permanent following a qualifying per

Join us as our new Cleaner, where you’ll play a vital role in creating an exceptional first impression for every guest.Your work is hands-on and practical, ensuring our holiday homes are cleaned to the highest standards so guests can enjoy a space that is safe, spotless, and beautifully presented.

The role Are you passionate about cleaning and health and safety? If so, then this will be the perfect role for you! Were looking to bring on board a Cleanerto join our welcoming and dedicated Estate Services team.You will be responsible for delivering a high-quality cleaning service at our site in

Key Responsibilities: Sweeping, mopping, vacuuming, and polishing floors.Dusting and wiping down surfaces.Cleaning toilets, washrooms, kitchens, and communal areas.Emptying bins and disposing of waste appropriately.Replenishing consumables such as soap, toilet paper, and paper towels.Cleaning window

Our Client are currently looking for an experienced Cleaner to join their team at a luxury residential development based in East London.Working 30 hours per week, salary is £19,890 per annum annually.Duties include: - To clean to a high standard all internal common areas as directed by the Houseke

Pertemps Bristol Commercial is seeking a Temporary Administrator based in Hereford for a 7-week assignment starting July 13.The role involves processing customer orders, updating internal systems, and preparing documentation.The ideal candidate will have previous administration experience, strong at

Equans UK & Ireland is seeking a Part time Afternoon Cleaner to join their team in Snaresbrook Crown Court, London.The position offers a permanent role working 10 hours a week with a competitive salary of £13.You will be responsible for maintaining cleanliness and hygiene standards at the site.The

Ever-Brite-Cleaning-Services is looking for a School Cleaner in Thurrock, Essex.Preferably, candidates should have experience in a similar role and possess a current Enhanced DBS Certificate, as assistance is available for the application process.

This will include classrooms, cloakrooms, offices, and halls.

Assist Security Group is seeking a Corporate Security Officer for the Bench Team in London.

Wilson James is seeking a diligent Front of House Officer in London to provide security and customer service.

Cleaning Operative - Evening Shift.Monday to Friday, 6:00 PM - 8:30 PM (2.We are seeking reliable and hardworking individuals to join our client's growing team in the Mundesley area.This is a fantastic opportunity for someone who takes pride in maintaining high standards of cleanliness and enjoys wo

ABM in Olympia, London is seeking a reliable and detail-oriented Window Cleaner to join our team.This role involves delivering high-quality cleaning services and adhering strictly to health & safety procedures.The ideal candidate will have proven window cleaning experience and strong communication s

Mitie Cleaning & Hygiene Services is seeking a Cleaner at Boldon School.The role involves maintaining high cleanliness standards while working within a team.Successful candidates will have a reliable and professional attitude, with specific training available for those new to cleaning.This part-time

Telford and Wrekin Council is seeking a Cleaner for Moorfield Primary School in the United Kingdom.The role is for a term‑time position working around 10 hours a week from 3.You will be responsible for cleaning and maintaining the school facilities to provide a safe and hygienic environment for ch