Leave jobs in Belfast - Page 5Create job alerts

Job Title: Supervising Social Worker Location: Belfast Contract Type: Permanent, Full Time Hours: 37.5 hours per week Salary: £36,000 - £46,000 dependent on experience (+£3,000 car allowance) About Kindercare Kindercare is a local, non-profit making Fostering Agency. We are part of the National Fostering Group the largest Independent Fostering Agency in the UK. Its official, we have been rated as a Great Place to Work 2025! 83% of employees at National Fostering Group say it is a great place to work, compared to 54% of employees at a typical UK based company ! Please read more about why our employees love working here: With over 20 years experience, National Fostering Group is the largest independent children's fostering group in the UK with a community of over 2,500 foster carers. In Northern Ireland, we work with Local Health and Social Care Trusts to provide the highest quality of care for children and young people. All of our fostering agencies across the UK are officially recognised by Ofsted, Welsh and Scottish regulators as either Outstanding or Good which we are extremely proud of. We also offer a 4 day working week - this means 80% of the hours for 100% pay! This will be given following a successful 6 month probationary period and is a performance based benefit. The role As a member of our brilliant team of social workers, you will understand the life-changing potential of a safe and supportive home life. You will play a key role in helping vulnerable children and young people find a foster home that can transform their future. You will also supervise and advise foster carers, and make sure that both carers and children have the support they need to thrive. You will visit homes and keep in touch with both carers and young people, becoming an essential point of contact for all a safeguarding champion with everyones best interests at heart. We keep caseloads lower to decrease risk and to offer more bespoke, person-centric focus. This means more time to work closely with both the young people and their carers to deliver the best possible outcomes. You will collaborate with our specialist clinical teams to identify and make available the right kinds of support, from occupational therapy to art therapy, and clinicians with specialism in trauma and attachment theory. As a key team member in one of our local fostering agencies, you will make sure that our children and young people are safe and secure, that they are well looked after, and that our high standards are consistently maintained. Through your passion and commitment, you will inspire carers to grow in confidence and achieve their potential, with a real impact on the children they care for. Who we are looking for You will be passionate about building incredible lives for children, and helping foster carers be the best they can be. You will be confident and imaginative, with either a BA or MA degree in social work and an energetic and open-minded approach. You will also need to be registered with the appropriate body and hold a full driving licence. Carers and children will be relying on you to create supportive, nurturing relationships, so you will need to show that youve had previous social work experience, with a record of working with young people who have a history of trauma and enhanced needs. You will be excited by taking on real responsibility, and you will be ready and willing to benefit from all the support we offer to help you do your job. You will also be generous with your own skills and experience, helping our whole team to excel. But what else is in it for you? Your health and wellbeing are important to us, so youll get an exceptional reward package including: • Up to 42 days annual leave each year (26 base entitlement + 1 One moment in time + 10 bank holidays + ability to buy up to 5 extra days), • Life Assurance, • Pension scheme with options to increase your contributions, • A wide range of health, wellbeing, and insurance benefits, • 100s of discount options valid in the UK and abroad, • Cycle to Work Schemes, • Electric Car Purchase Scheme We are committed to safeguarding and promoting the welfare of children and young people and we expect all employees to share this commitment and undertake appropriate checks. We are an Equal Opportunities Employer Job ID: Closing Date: 31st May 2026 Interviews scheduled for week commencing 8th June 2026 Skills: social work driver report writing Benefits: pension flexible benefits package WHJS1_NI

Why Apply for this? • Fantastic Exposure to a busy Accounts Environment, • Early Finish Friday - 2pm, • 22 days annual leave plus 11 statutory holidays, • Flexible Working About the Job Reporting to the Partner, the successful candidate will be responsible for ensuring the smooth execution of the companies accounts function. • Administer payroll for a portfolio of clients, ensuring all deadlines are met, • Prepare and submit all employer reports in line with statutory requirements, • Support the Payroll Manager in the smooth day-to-day running of the payroll bureau, • Assist with additional client reporting requirements, • Maintain a high level of accuracy and attention to detail across all work, • Liaise with both internal teams and external clients to resolve queries, • Support other areas of the firm where required, including ad hoc assignments, • Minimum 1-2 years' experience in practice or a payroll bureau environment, • Experience of HSC payroll (desirable), • Working knowledge of payroll software, • Strong proficiency in Microsoft Excel and Word, • Excellent written and verbal communication skills WHJS1_NI

About us : We are one of the top three automotive retailers in the UK, proudly representing 32 manufacturer brands, selling a huge range of new and used vehicles from over 150 dealerships across the UK and Ireland. We believe our people are our greatest asset, and we're committed to recognising the valuable contribution each person makes. That's why we continue to invest in a leading rewards and benefits package designed to support your career, wellbeing, and life outside of work. Accounts Administrator - Charles Hurst 6 month FTC contract Salary: Up to £26,250 per annum Hours: 37.5 hours per week. Monday - Friday 08.45 -17.00 Charles Hurst is seeking a reliable and detail-oriented Accounts Administrator to support our finance team on a Fixed Term Contract. This role is ideal for someone with strong administrative and numerical skills who enjoys working in a fast-paced environment. Key Responsibilities • Processing invoices, payments, and expenses, • Supporting accounts payable and receivable activities, • Maintaining accurate financial records and documentation, • Assisting with reconciliations and month-end processes, • Previous experience in an accounts or finance administration role, • Strong attention to detail and organisational skills, • Confident using accounting systems and Microsoft Excel, • Competitive salaries with structured pay scales and progression as you grow within the business, • Generous annual leave that increases with your length of service, • Enhanced family leave, including 6 months' full pay for maternity and adoption leave, and 2 weeks' full pay for paternity leave, • Eyecare vouchers to help cover vision care needs, • Smart Health - 24/7 access to GP services to support your mental and physical wellbeing, • Dental insurance for everyday dental care and unexpected treatments, • MyView PayNow - access a portion of your pay as you earn, with features to stream, save, and track your money through a user-friendly app, • Free will writing services to help plan for the future, • Discounted gym memberships to support an active lifestyle, • Travel insurance to help you explore with confidence, • Access to home and technology vouchers WHJS1_NI

A global employer with very flexible working patterns is looking to add a Management Accountant to their developing finance function. This position will help bolster the NI based finance function and report into a Senior Manager. The successful candidate will play a key role in supporting financial performance across multiple international entities, providing accurate financial information, insightful analysis, and contributing to the month-end process. Benefits * £45,000 £55,000 salary * Annual bonus scheme * 37 days annual leave * Private medical and dental cover * 4% employer pension contribution * Hybrid working 1 day in the office and 4 days working from home Key Responsibilities * Support the monthly management accounts process, including the preparation of accruals, prepayments, and journal entries. * Prepare and review balance sheet reconciliations, ensuring accuracy and completeness. * Analyse financial performance, identifying key trends and variances against budgets and forecasts. * Assist with budgeting, forecasting, and financial planning processes. * Partner with operational and finance teams to provide financial insight that supports business decisions. * Manage intercompany transactions and support financial reporting across international entities. * Work closely with external providers in relation to payroll, tax, and accounting support where required. * Contribute to continuous improvement initiatives About You * Qualified accountant (ACA, ACCA or CIMA). * Experience in management accounting, financial analysis, or commercial finance roles. * Strong analytical skills with the ability to interpret financial data and present clear insights. * Excellent communication skills * Highly organised with strong attention to detail. * Proactive problem-solver who thrives in a fast-paced environment. * Advanced Excel skills. Apply below or contact Marc at Artemis Human Capital for further information. Skills: Accountant ACA ACCA Benefits: Work From Home WHJS1_NI

Shape Your Leadership Journey Become a Supervisor Today Location:Belfast Boucher Shopping Park RP, Unit 8 Boucher Shopping Park, Belfast BT12 6HR Hours:hours a week with the opportunity to work more hours Shifts:Flexible,Monday-Friday 9am-9pm &Saturday-Sunday 9am-6pm Salary:per hour Why Superdrug? At Superdrug, our customers and our teams are at the heart of everything we do. Loved for our accessible health and beauty, value, variety, expert advice & top-notch service. Were all about personality, we aim to have fun, and we work hard to deliver That Superdrug feeling! Hard work? Absolutely. Rewarding? Always. Here's the exciting bit A great day includes: Can you motivate others and keep the energy high in a fast-paced environment? If youre all about leading a team, smashing targets, and building a career youre proud of, weve got the perfect opportunity for you. At Superdrug, your day will be all about making customers feel amazing, sharing our amazing Star Buys, and helping everyone leave the store feeling great. Youll be right there supporting the management team with the day-to-day running of the store, driving sales, and delivering the kind of customer service that keeps people coming back. From keeping shelves stocked and the store looking its best, to helping reduce shrinkage and till errors, youll play a big part in helping the team hit targets and keep things running smoothly. No two days are the same, and thats what makes it fun! What youll bring to the role: Supervisory or team leader experience within a fast-paced high street retailer preferred Understanding of retail Key Performance Indicators; including sales, profit and service The ability to help others to develop and improve their skills Willingness to carry out piercing services for our customers (training provided and not essential as part of the role) Why Youll Love Working with Us Up to 28 days holiday Up to 30% discount for you and a friend or family member Excellent training Great sales incentives Get instant access to Stream. A tool that lets you track your earnings in real-time, access a percentage of your pay as you earn it, learn easy tips for managing your money and save straight from your pay into pots for the future. Enhanced company sick pay and pregnancy loss and support WHJS1_NI

Working Arrangements: Fixed term contract with potential for permanency, 37.5 hours per week. 5 days office based in Titanic Quarter, Belfast. Free online parking. About Us: iTS is a Northern Ireland-based provider of technology and solutions for complex case management and other bespoke government and private customer solutions. We are a rapidly changing, ambitious and dynamic business located in Belfast. We seek people who, like us, put the client at the heart of everything they do. About the Role: We are seeking a detail-oriented service operator for the sortation, validating, scanning and processing of returned customer forms and documents across both paper based and system based workflows. The ideal candidate will have accurate data entry and strong organizational skills, with a commitment to maintaining confidentiality and compliance. Key Responsibilities: • Sort and scan all incoming post., • Review, verify and validate returned forms & documentation., • Accurate data entry on customer case management systems., • Maintaining various spreadsheet records., • Secure filing of hardcopy documents., • Any other ad hoc client administration as required for business processing. Essential Skills & Experience: • Previous administration experience in regulated industries is advantageous., • Experience with document verification or compliance processes., • Proficiency in Microsoft Office and data entry systems., • Ability to work independently and manage multiple tasks efficiently., • Strong attention to detail and accuracy, adhering to precise processes, and escalating queries as necessary., • Ability to handle sensitive information with discretion., • Compliance with data protection regulations and internal policies. Being a member of the team at iTS, you will be rewarded by our company benefits, these are just a few of what is on offer: • 26 days annual leave, • Benefits which can be opted into such as private healthcare insurance, dental insurance, and critical illness, • Pension scheme including ER contributions up to 10% matching Skills: Admin Duties Compliance Microsoft Suite Multitasking Attention to detail Process Control Data Protection Benefits: Parking Medical Aid / Health Care Pension WHJS1_NI

• Job Reference: RAGW, • Job Title: Groundworker (Social Housing), • Salary: £30,160 to £32,814 DOE + van / fuel card / package, • Pension Scheme, • 24 days annual leave (+ public holidays), • Life Cover equivalent to 1.5 times annual salary, • 24/7 Employee Assistance Program and access to mental wellbeing app, • Employee discount shopping schemes on major brands and retailers, • Gym membership discounts, • Cycle to work scheme, • Flagging, • Blocked paving, • Tarmac, • Concreating, • Kerbs, • Excavations, • Footings, • Ramps Additional duties include: • Clear and prepare sites by removing debris, vegetation and existing structures, • Lay and level foundations ensuring precise measurements and alignment, • Install and maintain drainage systems including pipes, manholes and water management systems, • Set up and dismantle temporary structures such as site offices and storage units, • Mix and pour concrete for foundations, footpaths and other structures, • Relevant industry training and qualifications, • Minimum 2 years' experience in a Groundworker role, • Proficiency in operating groundworks machinery and tools (with relevant qualifications), • CSR Card, • High level customer service skills, • Excellent communication skills, • Ability to demonstrate good teamwork values, • Full, valid, clean driving license For further information on this vacancy, or any other Built Environment job in Belfast or wider Northern Ireland, please apply via the link below or contact Robert Apps for a confidential discussion IND03 Skills: Groundworker Groundworks Construction Maintenance Social Housing Benefits: • van / fuel card / package WHJS1_NI

Staff Quality Assurance Engineer CME Group is seeking a Staff QA Engineer to set the strategic vision for quality assurance practices across the Trade Dissemination value chain. As a Staff QA you will define our product QA strategy, drive best practices, and help ensure successful, high-quality feature deliveries across our Trade Dissemination products that allow our customers to receive their trading information and manage their risk in real-time. Our customers rely on these so reliability is critical. This role is not just about writing or executing tests, you will define our strategy whilst influencing both product and engineering along the way. Key Responsibilities Define the Quality Vision: Serve as the technical authority defining the QA strategy for the Trade Dissemination value chain and influencing product and engineering leadership on direction and prioritisation. Drive High-Impact Initiatives: Take accountability for the successful delivery of Trade Dissemination initiatives. You will capture and communicate complex risks and dependencies while ensuring senior leadership is proactively informed. Lead on Complex Root Cause Analysis: Lead and drive product level investigations to resolution during incidents and investigations demonstrating calm and decisive leadership. Set Engineering Quality Standards: Champion a culture of delivering high quality engineering solutions with an emphasis on automation and repeatability. Identify and drive process improvements, mentoring other engineers and contributing to critical architectural decisions from a quality assurance and testability perspective. What We're Looking For Demonstrable professional experience leading the QA function providing technical oversight and strategic direction for a highly technical team. Distributed Systems Testing: Experience designing tests for resilience, fault tolerance, and data consistency across distributed, cloud-native architectures. Observability and Testability: Expert use of monitoring tools (e.g., Prometheus, Grafana, OpenTelemetry) to validate system quality in production and pre-production environments. Expert level skills in combining quality engineering with the ability to quickly absorb complex business and technology concepts, and translate them into actionable QA strategies and delivery plans Exceptional communication and stakeholder management skills, with the ability to influence and align senior leadership and principal engineers. A strategic mindset, with the ability to connect technical decisions to business impact and long-term goals. Desirable Skills Domain Expertise: Experience with ultra-low latency (ULL) trading platforms or large-scale financial applications in capital markets. Knowledge of cloud-native architecture, particularly on Google Cloud Platform (GCP), with a strong command of infrastructure-as-code (e.g., Terraform, Ansible). CI/CD Leadership: Experience architecting and optimising CI/CD pipelines for mission-critical services. Why CME Group Be part of a global leader in financial services technology. Work on cutting-edge technology in a collaborative and innovative culture. Receive a competitive compensation and benefits package. Grow your career in SRE with an organisation committed to this modern approach. Join CME Group and play a crucial role in ensuring the stability and performance of our global trading applications. Apply now to be a part of our dynamic Trade Dissemination team! Company Benefits: Bonus Programme Equity Programme Employee Stock Purchase Plan (ESPP) Private Medical and Dental coverage Mental Health Benefit Programme Group Pension Plan Income Protection Life Assurance Cycle To Work EV Car Benefit Scheme Gym Membership Family Leave Education Assistance - MBA/Advanced Degree/Bachelor Degree Ongoing Employee Development Training/Certification Hybrid Working CME Group: Where Futures are Made CME Group is the world's leading derivatives marketplace. But who we are goes deeper than that. Here, you can impact markets worldwide. Transform industries. And build a career by shaping tomorrow. We invest in your success and you own it - all while working alongside a team of leading experts who inspire you in ways big and small. Problem solvers, difference makers, trailblazers. Those are our people. And we're looking for more. At CME Group, we embrace our employees' unique experiences and skills to ensure that everyone's perspectives are acknowledged and valued. As an equal-opportunity employer, we consider all potential employees without regard to any protected characteristic. Important Notice: Recruitment fraud is on the rise, with scammers using misleading promises of job offers and interviews to solicit money and personal information from job seekers. CME Group adheres to established procedures designed to maintain trust, confidence and security throughout our recruitment process. Learn more here. To be considered for this role you will be redirected to and must complete the application process on our careers page. To start the process click the Continue to Application or Login/Register to apply button below.

Vickerstock are working in partnership with a civil and structural engineering firm on the appointment of a Health & Safety Coordinator . As a Health & Safety Coordinator, you will prepare documentation as part of the Principal Designer duties in accordance with the CDM Regulations, reviewing Health & Safety information from Designers and Contractors with occasional site Health & Safety inspections. What's in it for you? • Hybrid working arrangements, • Flexible start / finish times, • Attractive annual leave policy (32 days), • Health care plan, • Life assurance (x4 salary), • Occupational Sick Pay, • Company pension scheme, • Funded career development opportunities, • Assist in the delivery of the Principal Designer role in accordance with the CDM Regulations, • Liaise with Design Team Members, Contractors, Clients, • Provide CDM and H&S advice to project team members, • Prepare Pre-Construction Information and H&S Files, • Review Contractors' Construction Phase Plans, • Represent the company at Design Team / Client meetings, • Relevant experience in a similar role, • NEBOSH General or Construction certification, • Awareness of Health & Safety / CDM legislation, • Knowledge and experience of CDM regulations, • Excellent oral and written communication skills, • IT and numeracy skills (MS Office), • Membership of accredited industry body (IOSH), • NEBOSH Diploma or equivalent Skills: Health and Safety Civil Engineering CDM NEBOSH Engineering Construction ISO WHJS1_NI

The Home Join Our Caring Team at Cairnmartin Court Care Home Cairnmartin Court is a modern, welcoming care home offering specialised Residential and Nursing Dementia care across 62 comfortable rooms. Conveniently located just 13 minutes from Belfast city centre in west Belfast, our home is close to shops, amenities, and public transport links. Our dedicated, trained team provides compassionate, person-centred care 24 hours a day, ensuring every resident feels valued and supported. At Cairnmartin, we create a warm, homely atmosphere a place filled with smiles, laughter, and genuine connections. We take the time to get to know each resident personally, placing their needs and preferences at the heart of all we do. If youre passionate about making a positive difference in peoples lives and want to work in a friendly, supportive environment, wed love to hear from you. The Role The role of a Registered Nurse in our services is a key position in our mission to provide excellent and inclusive care. The Registered Nurse is a leadership role, playing a vital part in managing the care of our residents and providing high-quality and person-centred care. The Registered Nurse will work collaboratively with multidisciplinary teams to assess, plan, implement and evaluate care plans tailored to the individual needs of our residents. We pride ourselves on being able to deliver excellent care to our residents, as a Registered Nurse you will support the management of shifts, ensuring the safety of all residents and our team. The role of Registered Nurse is always evolving and having a commitment to personal and professional development will ensure that you are able to make a positive difference in the lives of our residents and their families. About The Role Main Responsibilities Delivering person centred care to each resident Assess and monitor the physical health of residents within care plans To offer support and supervise all care staff or new recruits Ensure effective communication of any concerns relating to resident care Complying with relevant regulatory and statutory requirements Undertake any other duties that may be reasonably required as designated by the Home Manager The Benefits Paid annual leave The chance to be part of a growing healthcare company Continuous professional development and training Values-led culture Overtime available at an enhanced rate Opportunities for progression Pension plan (if applicable) Attractive hourly rate Access NI cost covered NMC reimbursed after qualifying period Uniforms and PPE supplied Monthly incentives and recognition awards Free parking We DO NOT offer sponsorship for this role. This is a Casual/Bank Role. Healthcare Ireland are an equal opportunities employer and welcome applications from all suitably qualified persons. Required Criteria Valid UK NMC pin Minimum of 6 months nursing experience The Right to Work in the UK The ability to work independently and supervise a team Have a good standard of written and oral English Desired Criteria A minimum of 6 months nursing experience Experience gained in a care home setting Skills Needed About The Company We are passionate about providing the highest standards of care in safe, positive and flexible environments, which enable each person who uses our services to achieve their potential. We are committed to providing each employee with a fulfilling working environment, encouraging personal and professional development. We aim to be a first class, independent organisation delivering innovative, collaborative and value for money services. Our ultimate purpose is to work with the people who use our services and their families and friends, to enable them to take control of their lives. Company Culture Were always on the look out for people who care, whether thats caring for our residents, or in one of our roles like laundry, kitchen, administration or maintenance. Our passionate, ever-growing team means that youll be working with people who pride themselves on the work they do. Each of our Homes and our Head Office work together to achieve something excellent that truly makes a difference in peoples lives. Caring for our residents is at the heart of all we do, and wed love to have you join the team. Company Benefits Healthcare Ireland Group is not just a workplace; it's a community where your work has a purpose, and your contributions are valued. If you're passionate about making a difference and are seeking a rewarding career in healthcare, we welcome you to explore opportunities with us and help continue our legacy of excellence in care . Retirement plan and/or pension, Employee development programs, Free parking, Competitive salary, Social Opportunities, Employee Recognition Scheme, Culture of recognition, On the job learning Salary £22.00 per hour Benefits: Retirement plan and/or pension Employee development programs Free parking Competitive salary Social Opportunities Employee Recognition Scheme WHJS1_NI

City View Court City View Court, situated in Belfast, delivers person-centred nursing care for up to 100 residents. Recently refurbished, City View Court is a light, modern and spacious home offering a range of specialist care services for older people, including residential, dementia and general nursing. Our kind and compassionate team not only provides care, but shares their good company, companionship and assistance whenever required, ensuring that all residents feel listened to and supported. Whilst all private bedrooms are fully furnished residents are welcome to personalise the space with their own accessories and furniture. Residents at City View Court can enjoy the comfortable lounges and dining spaces to relax, enjoy a nutritious meal freshly prepared by our chef, or to socialise. Despite its city centre location, City View Court boasts a calm, restful atmosphere. About the role: The role of the Domestic Assistant is essential in our mission to provide excellent care. Supporting the Housekeeper with the environment of the Home, the Domestic Assistant will contribute to the wellbeing and quality of life of our residents. The Domestic Assistant will ensure that the Home is clean, tidy and welcoming at all times. The Domestic Assistant role at Healthcare Ireland Group works closely with the care teams and residents, building trusting relationships to create a comfortable environment where our residents feel safe and cared for. From ensuring that rooms are clean to tidying communal areas, every task contributes to the value that we add to the lives of our residents. About The Role Main Responsibilities • Ensure the expected cleanliness and hygiene standards are achieved throughout the home, • Cover domestic duties as assigned, • Identify and report any damage, faults or other issues to maintenance or management, • Adhere to the cleaning and auditing schedule, • Use and store cleaning products in accordance to COSHH regulations, • Paid annual leave, • The chance to be part of a growing Healthcare company, • Continuous professional development and training, • Values-led culture, • Overtime available at an enhanced rate, • Opportunities for progression, • Pension plan (if applicable), • Attractive hourly rate, • Access NI fee paid for, • Uniforms and PPE provided, • Monthly incentives and recognition awards Healthcare Ireland are an equal opportunities employer and welcome applications from all suitably qualified persons. Required Criteria • A good standard of both verbal and written English, • Relevant experience for the role, • The Right to Work in the UK Desired Criteria • Previous care home experience, • Basic knowledge of COSHH, Health and Safety and Fire Regulations Skills Needed About The Company We are passionate about providing the highest standards of care in safe, positive and flexible environments, which enable each person who uses our services to achieve their potential. We are committed to providing each employee with a fulfilling working environment, encouraging personal and professional development. We aim to be a first class, independent organisation delivering innovative, collaborative and value for money services. Our ultimate purpose is to work with the people who use our services and their families and friends, to enable them to take control of their lives. Company Culture Were always on the look out for people who care, whether thats caring for our residents, or in one of our roles like laundry, kitchen, administration or maintenance. Our passionate, ever-growing team means that youll be working with people who pride themselves on the work they do. Each of our Homes and our Head Office work together to achieve something excellent that truly makes a difference in peoples lives. Caring for our residents is at the heart of all we do, and wed love to have you join the team. Company Benefits Healthcare Ireland Group is not just a workplace; it's a community where your work has a purpose, and your contributions are valued. If you're passionate about making a difference and are seeking a rewarding career in healthcare, we welcome you to explore opportunities with us and help continue our legacy of excellence in care . Retirement plan and/or pension, Employee development programs, Free parking, Competitive salary, Social Opportunities, Employee Recognition Scheme, Culture of recognition, On the job learning Salary £12.73 per hour Benefits: Retirement plan and/or pension Employee development programs Free parking Competitive salary Social Opportunities Employee Recognition Scheme WHJS1_NI

Location: Belfast, United Kingdom Thales is a global technology leader with more than 83,000 employees on five continents. With over 7,500 people in the UK, operating across defence, space, aerospace, and digital security, we help build a future we can all trust. Thales supports the security and stability of our nation by providing extraordinary technology to our customers, as well as delivering social value to the UK with our products and services. Thales people architect solutions that are relied upon to deliver operational advantage at every decisive moment throughout the mission. Defence and armed forces customers rely on us to deliver the full range of defensive systems for land, sea, and air. From early warning, to threat neutralisation, our platforms cover all levels from very short-range systems, to extended protection across the entire battle-space including Airspace Mobility Solutions, Vehicles and Tactical Systems and Missile Defence, Optronics, and Radar. Together we offer fantastic opportunities for committed employees to learn and develop their career with us. At Thales UK, we research, develop, and supply technology and services that impact the lives of millions of people each day to make life better, and keep us safer. We innovate across the major industries of Aerospace, Defence, Security and Space. Your health and well-being matters to us and thats why we offer you the flexibility to do whats important to you; whether thats part time hours, job sharing, home working, or the ability to flex your start and finish times. Where possible, we support a working pattern that suits your lifestyle and helps you reach your ambitions. Join Thales as a Machine Technician Be Part of Innovation in Manufacturing! POSITION: Manufacturing Technician DEPARTMENT: Manufacturing LOCATION: Belfast Our Opportunity As a CNC Machinist, you will support lead the manufacture and inspection of high precision components, sub-assemblies, tooling and fixtures in a total quality team environment in order to meet production schedules and requirements. About You As a Machine Technician, you will ideally have served an apprenticeship as a turner or skilled machinist and with proven post apprenticeship experience with mill/turn or multi-axis being advantageous. To be successful in this role, you will already have the ability to understand information given on technical drawings and apply that information in the programming and in the operation of CNC machine tools. Key Duties • Responsible for the set-up and operation of major plant equipment within a high volume production environment i.e. C.N.C. machine tools in order to manufacture high precision missile components, Tooling, Gauging, Jig and fixture details and R&D hardware., • Shop Floor programming using M.D.I. and G codes to produce C.N.C. programmes for the manufacture of R&D hardware and Tooling and to edit C.N.C. part programmes during prove out and production runs and to ensure any changes are fed back to manufacturing engineering to maintain traceability., • Responsible for the step by step prove out of program by diagnosing errors therein to prevent damage to plant equipment and ensure correct manufacture of components., • Responsible for recording data on statistical process control (S.P.C.) data base units or control charts. Monitoring and analysing such data to resolve problems in controlling the machining process., • Responsible for calibration/plausibility checks on post process gauging (P.P.G) to assure correct part measurements., • Responsible for the quality of machine components to drawing specification and quality standards, using meteorology equipment and to ensure equipment is within calibration requirements., • Accountable for own productivity and quality and the recording any necessary quality defect data on factory management system (F.M.S.) to facilitate traceability., • Responsible for progressing finished components to other work groups by actively participating in materials handling and processing correct progress data on the factory management system (F.M.S.), • Responsible for identifying any errors found within process sheets and measurement plans and to ensure any such errors are reported to M.E. for correction., • Responsibility to work in a continuous improvement environment to achieve maintain and improve product quality and to strive to reduce machining cycle times, lead time and production costs., • Detailed training of other employees and apprentices in the most effective methods of performing tasks & duties. Why Thales? • By joining us, you become part of a global powerhouse at the forefront of aerospace, defence, and security technologies. We offer you:, • A supportive, inclusive workplace where your contributions make a difference., • Opportunities to develop your skills with expert training and clear career pathways., • The chance to work on impactful projects that protect and connect communities worldwide., • A company culture grounded in innovation, collaboration, and respect. What we can offer • 4 day working week, • Pension Scheme, • 28 days annual leave (Plus Bank Holidays), • Progression and Development Opportunities, • 24/7 Employee Assistance Program and access to mental wellbeing app, • Employee discount shopping schemes on major brands and retailers You will be supported by an additional ongoing training program over 2-3 years on steadily larger and more complex jobs to meet the manufacturing and quality requirements in line with the total quality concept. Please note current working hours are due to change and any successful applicants must be open to future shift patterns. #LI-SC1 In line with Thales' Baseline Security requirements, candidates will be asked to provide evidence of identity, eligibility to work in the UK and employment and/or education history for up to three years. Some vacancies may require full Security Clearance which can require further evidence to be provided. For further details of the evidence required to apply for Baseline and Security Clearance please refer to the Defence Business Services National Security Vetting (DBS NSV) Agency. At Thales we provide CAREERS and not only jobs. With Thales employing 80,000 employees in 68 countries our mobility policy enables thousands of employees each year to develop their careers at home and abroad, in their existing areas of expertise or by branching out into new fields. Together we believe that embracing flexibility is a smarter way of working. Thales UK is committed to providing an inclusive and barrier-free recruitment process. We will provide reasonable adjustments and support to ensure neuro-diverse applicants or those with a disability or long-term condition can be their best during the recruitment process. To request an adjustment, if you need this job advert in an alternative format or if you have any questions about the recruitment process, please contact Resourcing Ops for mid to senior roles, or the Early Careers Team for graduate and apprentice roles. At Thales, we ensure equal opportunities, pay and working conditions for all. The benefits we offer include private medical insurance, buying or selling annual leave, cycle to work schemes, employee discounts, paid volunteering day, stocks and shares, annual bonus and much more depending on the role. Read more about our benefits here. We are committed to creating a workplace where everyone feels valued for who they are and the unique strengths they bring. Discover more about our programmes, employee networks, wellbeing policies, and inclusive features here. If this role isnt quite right for you, we encourage you to join our talent community where your details will be shared with our recruitment teams for other potential opportunities. Join the Talent Community here. Join Thales in the UK Innovate with us and shape the future! WHJS1_NI

Choice Housing is one of Northern Irelands leading housing associations, we employ over 500 people with a 50-year legacy of enriching lives through the provision of safe, high quality, and affordable homes. We manage over 14,000 homes and support around 40,000 tenants, delivering a wide range of housing solutions including general needs, sheltered housing, support accommodation, and homes for families with complex needs. Housing Officer 37 hours Salary Scale : £32,913 £42,964pa Job Reference: HO Choice is seeking to recruit a Housing Officer to provide an efficient, responsive and excellent customer focused Housing Management Service to its customers. To be successful, you will need to have comprehensive knowledge and experience of delivering housing management services and have a proven track record of successfully managing Arrears, Allocations, Voids and Anti-Social Behaviour. Essential criteria:- OR 3 years experience as a Housing Officer (or equivalent) within the last 5 years AND (applicable to all) • Working knowledge of the rules of the Housing Selection Scheme; to include allocation of properties, assessment of transfer applications, assignments, mutual exchanges etc., • Experience of Microsoft Office programmes including Excel and Word, • 22 days annual leave plus an additional 5 days after 5 years service, and 12 public holidays,, • Flexible working hours including up to 2 days flexi leave per month,, • Hybrid working,, • Essential car user allowance,, • 6% pension contribution,, • Paid maternity and paternity leave,, • Death in service benefit x3 annual salary,, • Bereavement leave,, • Learning and Development opportunities to include paid courses relevant to your role, Further information including the job description, personal specification and further benefits can be found on the link when clicking apply! Completed application forms should be returned by 5pm, Tuesday 19th May 2026. Please note, the Association reserves the right to create a reserve list following the interview process. NB: The panel may enhance the criteria in order to facilitate short-listing of the post. Choice Housing Ireland Limited is an Equal Opportunities Employer WHJS1_NI

Social Value Project Lead McLaughlin & Harvey is one of the leading Civil Engineering and Building Contractors operating throughout the UK and Ireland. We are looking to recruit a Social Value Project Lead to deliver our social value commitments across projects in Northern Ireland, ensuring we meet local planning obligations and leave a meaningful, lasting legacy in the communities where we work. Key Responsibilities As a Social Value Project Lead, you will: • Design, implement and monitor social value commitments across Northern Ireland projects, ensuring alignment with the Social Value Model 2020, Public Services (Social Value) Act 2012, and any local planning obligations, • Develop project specific Social Value Plans tailored to client priorities, local authority requirements and local community needs, • Work collaboratively with internal teams, clients, supply chain partners and community stakeholders to maximise social, economic and environmental outcomes throughout the project lifecycle, • Track and report on local procurement activity, SME engagement, Voluntary, Community and Social Enterprise sector (VCSE) involvement and other economic benefits in line with reporting expectations, • Support procurement processes that enhance local economic benefit and contribute to wider community wealth building outcomes, • Work with schools, colleges, universities and training providers to deliver careers talks, site visits, placements, curriculum support and mentoring initiatives to meet our social value commitments, • Build and maintain strong relationships with local authorities, community organisations, residents groups, business networks and charities, • Facilitate volunteering programmes and encourage participation from project teams and the supply chain, • Support delivery of Considerate Constructors Scheme (CCS) requirements to achieve high scores and drive best practice, • Track, measure and report social value outcomes using recognised frameworks such as National TOMs, the Social Value Model, and client specific metrics, • Produce regular reports, dashboards and evidence packs for clients, auditors and internal leadership, ensuring clear demonstration of compliance and impact We are looking for someone who has: • Experience delivering social value or community engagement activities, • Desirable to have experience using social value measurement tools, including National TOMs, Social Value Portal or equivalent approaches, • Strong communication, coordination and organisational skills, • Excellent stakeholder engagement capability, with confidence working alongside community groups, local authorities, education providers, supply chain partners and clients, • Proficiency in Microsoft Office, • A passion for community development and inclusion, • Flexibility to travel between projects within a defined region, • A full driving licence, • Competitive salary, • 33 days annual leave, • Flexible and hybrid working options, • Generous pension contributions Decisions relating to recruitment, salary, training, evaluating performance, or termination are made fairly, and we provide equal employment opportunities to all qualified candidates and employees. We examine our unconscious biases and take responsibility for always striving to create a collaborative and inclusive environment that makes every employee and candidate feel welcome. As a Disability Confident employer we are committed to inclusive and accessible recruitment where we will provide all reasonable adjustments at interview stage and beyond and commit to extending an interview to disabled candidates who meet the minimum job role requirements. WHJS1_NI

This is an exciting opportunity to work for a friendly team in an industry leading utility company. You will be joining a team of people who are united in achieving our corporate objectives and who are willing to go the extra mile to deliver excellent service to our customers. As an equal opportunity employer, we welcome applications from all ages and backgrounds. Key Responsibilities: Regularly reviewing the monitoring data from the Hybrid Heat Pump Programme to identify issues as they arise and prepare regular updates for key internal and external stakeholders including the Department for the Economy and the Utility Regulator Undertaking in-depth analysis of the performance of the installed hybrid heat pumps to support the drafting of detailed operational reporting and facilitating the independent review of the results by an independent academic evaluator Engaging with, and challenging, operational and strategic energy transition colleagues and provide research driven and analytical informed perspectives on the issues, challenges, and opportunities relevant to advancing low carbon heat goals Monitor low carbon heat related public policy developments in Northern Ireland, Ireland, the UK and across Europe to develop insights that empower the business to act decisively in a rapidly changing industry. Regular participation in multidisciplinary collaborative forums, featuring internal and external partners to progress the successful delivery of low carbon heat workstreams including joint academic/industry research projects. Essential Qualifications Educated to degree level Essential Experience Three years experience working in either a data analyst role, a research role, an economist role, a government policy/public affairs role or equivalent. Strong qualitative & analytical skills, along with the ability to communicate complex analysis Demonstratable experience delivering succinct, structured, written briefings. Whats in it for you? On target annual bonus (6-9%) you will receive 22 days annual leave plus 11 bank holidays (this increases with length of service). enrollment into the Company pension scheme on commencement and upon meeting qualifying criteria the Company will match your pension contributions up to 6%. life assurance whist employed by the Company. private medical insurance upon meeting qualifying criteria. free staff transport from city centre free staff car parking Does this sound like you? We hope you can say Yes to all of the characteristics below - they are in the DNA of all our fantastic employees. Are you someone who: Respects diversity and behaves in an inclusive manner. Has a can-do attitude. Can evolve and adapt quickly. Wants to deliver positive change to the customer and communities that we serve. Recognises that we can achieve more through teamwork. If this sounds like you then we definitely want to hear from you! A little more about us We were established in 1996 to bring natural gas to the Greater Belfast area of Northern Ireland, where there was previously no natural gas distribution network. Since 1996 local, national and international partnerships have delivered an investment of over £500 million into the Northern Ireland economy and the wider natural gas industry now provides employment to over 2,500 people. We continue to invest in infrastructure that currently has in excess of 256,000 domestic and business customers connected, and continues to grow at around 8,000 new customers each year. Skills: Analyst Benefits: Group Life Assurance Pension Free Parking Staff Bus Private Medical Insurance WHJS1_NI

Salary: £13.11 Contract Type: Temporary Hours: As and when required Job Reference Number: B DunRSW Job Location: Dundonald, Castlereagh, United Kingdom Closing Date: Saturday, May 30, 2026 About This Role We are seeking Relief Support Workers to join our team. You will work alongside people who use our services, supporting in a range of activities, including developing independence in daily living, accessing work/education and leisure activities. At Autism Initiatives we work alongside autistic people, providing specialist services tailored to each individual. Our Values, shown below, underpin every aspect of the organisation's culture and activities in NI: Autism-Focused, Respect, Excellence, Empowerment, Collaboration, Commitment to Change and Rights-based. Given the nature of the role, these positions are subject to an enhanced Access NI check for the successful applicants. The cost of which will be met by the organisation. You will enjoy an enhanced range of benefits designed to reward the outstanding support that staff provide. Some of these benefits start immediately, whilst others are awarded at later dates in recognition of loyalty, dedication and long service. Competitive salary. Employer pension scheme. Enhanced company sick pay. Enhanced maternity pay. Access NI paid. NISCC fee paid after two years service. Generous paid annual leave. Incremental increases to annual leave. Paid bank and public holidays. Birthday leave. Option to buy and sell annual leave. Long service awards. Monthly staff cash prize draw. Blue light discount card. Employee Refer a Friend initiative. Free Autism specific training. Comprehensive induction training. On the job learning. Buddy/mentor for new staff. Funded QCF development opportunities. Continuous learning & development opportunities. Line management support structure. Regular 121 meetings. Annual Performance review. Culture of recognition. 24/7 employee assistance programme (confidential counselling helpline) available from day one of employment. Offering free support from experts on a wide range of subjects from childcare and probate, to managing money and work life balance. Medicash health scheme, subject to eligibility. Menopause support line as part of Medicash scheme. Career break policy. Cycle to work scheme. Compassionate & Bereavement leave. Wagestream financial planning and support App - enables you to access money earned before pay day, set up savings and more. Essential Criteria: Working, voluntary or personal knowledge of providing care and/or support. Be flexible to work on a rota basis that includes job rotation in various services, unsocial hours and weekends. NISCC registered or apply to register on appointment. Desirable Criteria: Must be able to drive a manual vehicle as there is a requirement to drive the people we support in their own vehicles. Autism Initiatives are an Equal Opportunities employer. We are committed to Equality, Diversity and Inclusion in employment and service delivery. Registered Charity No: XR72211, NIC . Currently we are unable to provide Sponsorship or take over Sponsorship of an employment Visa. Benefits of working with us In addition to competitive pay rates, a contributory pension, and generous holiday entitlements, you'll have access to a range of additional benefits designed to recognise and reward the exceptional support our staff provide. Some benefits are available immediately, while others are awarded over time to recognise loyalty, dedication, and long service. Please note that benefits may vary by role, location, and length of service. Full details of your benefits package will be available once you join. Below is an overview of some of the benefits you may be eligible for: Monthly staff cash prize draw Your birthday off work every year Medicash health scheme (including reimbursement for medical costs, gym discounts, and more) Employee Assistance Programme - free expert support on childcare, probate, money management, and work-life balance Additional paid holidays after 1, 2, and 3 years of service Extra paid holidays for milestone service years Financial wellbeing programme offering flexible access to pay Cycle to Work scheme Career break scheme Wagestream financial planning and support app - access earnings before payday, set up savings, and manage your finances To be considered for this role you will be redirected to and must complete the application process on our careers page. To start the process click the Continue to Application or Login/Register to apply button below.

Job Summary: The Human Resources Generalist role is ideal for someone who enjoys variety and wants to make a meaningful impact across all areas of HR while supporting our value-driven organisation. As the HR Generalist, you will provide day-to-day HR support to staff and managers, covering key areas such as employee relations, HR administration, policy and process implementation. Youll play a vital role in maintaining a positive, inclusive working environment and ensuring HR practices are effective, compliant, and aligned with our values. This is a hands-on role with plenty of opportunity to develop and grow within a supportive, purpose-led organisation All applicants for positions at the level of Manager or above within Praxis Care are required to disclose any actual, potential, or perceived conflicts of interest. This includes any direct or indirect involvement with individuals, firms, companies, or organisations that have, or are seeking to establish, a contractual relationship with Praxis Care. Failure to declare such interests may result in disqualification from the recruitment process. If a conflict of interest is identified after an appointment has been made, it may constitute grounds for disciplinary action, up to and including dismissal. Key Accountabilities: • To provide advice and support to Line Managers and HR colleagues on all aspects of the employment life cycle including but not limited to; investigation, disciplinary, absence management, performance management, grievance procedures, payroll and benefits and provide recommendations on appropriate course of action, • To review and guide on documentation, letters and process in a timely manner to ensure relevance, consistency and minimise any risk to the organisation, • To be self-aware and confident with difficult conversations and be able to adapt the approach to the situation, • To support the HR Team in the development and delivery of employee engagement plans that support the overall employee engagement strategy Requirements of the Role: • You will be required to participate in the company appraisal and staff review process, • To adhere to and model the company values, behaviours and competencies at all times, • To carry out all duties of the post in accordance with Praxis expectations, regulations and policies, • To carry out additional duties of the role and all other required duties as and when necessary Essential and Desirable Criteria: Experience & Qualifications: • Strong communication skills and the ability to translate thinking clearly to others, • Analytical and methodical in dealing with work and ability to effectively manage workload in a structured and efficient way, • Highly initiative driven and creative in approach to solving problems, • Proactive and solution oriented and plans ahead to achieve outcomes, • Constantly seeks value based outcomes and strives for continuous improvement, • Reliable, personable and positive in approach Required Criteria • Right to Work in the UK, • Degree educated and CIPD Qualified, • 2 years HR experience Desired Criteria • Degree in HR management, • Level 5/7 CIPD Qualified Skills Needed Communication, Teamwork, Employee Relations, Legislation Compliance About The Company Praxis Care provides a wide variety of services to vulnerable adults and children, supporting individuals with mental ill health, learning disabilities, autism and dementia. Our staff teams are essential to ensuring the provision of these services. As a new member to the team, you can expect to be trained and supported in a structured fashion to achieve the high standards expected by the people we support and mandated by our regulators. Company Culture Our core values include compassion, integrity, teamwork, innovation and resilience. We also ensure that kindness and respect is integral to every role within Praxis Care and these values are fundamental to the provision of care we deliver to the people we support. If you are interested in a role that is rewarding, varied and positively impacts the lives of those we support, then we want to hear from you. ? ? Praxis Care: Company Limited By Guarantee | Registered Office 25-31 Lisburn Road, Belfast, BT9 7AA| Registered in Northern Ireland (NI ) | Registered with the Charity Commission Northern Ireland (NIC ) | Registered in Ireland ) | Registered Office: Unit 18, Ardee Business Park, Hale Street, Ardee, Co Louth, A92 XH76 | Registered with Charities Regulatory Authority ) | ?Registered as a Charity in the Isle of Man (0826) Company Benefits Why Join Praxis Care? * Great Work Environment : Compassionate, supportive, and inclusive team culture. * CARE for Your Physical & Mental Health : Access to occupational sick pay, a confidential counselling service, and employer-funded healthcare schemes. * Financial Benefits : Competitive salary, pension plan, and refer-a-friend bonuses. * Career Development : Continuous professional development with opportunities to gain recognized qualifications, such as QCF3/5, and clear career progression pathways. * Work-Life Balance : Paid annual leave which increases with length of service, and flexibility in working hours. * Other Perks : PPE provided, long service awards, savings via the Cycle to Work scheme, and coming soon, early access to earned wages through salary advance software. Want to learn more about what benefits Praxis Care has to offer? Click the link below for full access to our employee benefits brochure and see what makes this opportunity even more rewarding: Benefits- Vacation, Paid time off, Paid sick days, Retirement plan and/or pension, Flexible schedule, Employee discounts, Sabbatical leave, Cycle to work, Referral bonus, Competitive salary, Long service recognition, Employee Assistance Scheme, Wellbeing Scheme, Blue Light Card, Social Opportunities, Employee of the Month, Employee Recognition Scheme, Culture of recognition, On the job learning, Progression opportunities, Long service awards, Service recognition increases to annual leave, Staff celebration events Salary £26,746.35 - £35,133.93 per year Skills: Communication Teamwork Employee Relations Legislation Compliance Benefits: Vacation, Paid time off Paid sick days Retirement plan and/or pension Flexible schedule Employee discounts Sabbatical leave WHJS1_NI

Job description Business Area Across various NIO Business Areas - we will use this competition to place individuals in roles in Corporate Operations Group, Security & Protection Group & Fiscal, Economy & Trade. In addition, a reserve list will be created which may be used for future Grade 6 roles which occur over the next 12 months across all NIO business areas. Role Title Northern Ireland Office Grade 6 Roles Terms of Appointment Permanent Grade Grade 6 Location Northern Ireland or London Erskine House, 20-32 Chichester St, Belfast BT1 4GF or 1 Horse Guards Road, London, SW1A 2HQ Occasional travel between Belfast and London will be required. Vacancy Manager Clare Sloan Applications Invited from External Candidates and Existing Civil Servants on level transfer and promotion New entrants to the Civil Service will be expected to join on the minimum of the pay range. Existing Civil Servants will have their salary calculated in accordance with the Departments pay on transfer / pay on promotion rules. The national starting salary is £71,381. The London starting salary is £75,674. Your salary will be dependent on your base location. Background The Northern Ireland Office supports the Secretary of State for Northern Ireland in promoting the best interests of Northern Ireland. We make sure that Northern Ireland interests are represented within the UK Government and that UK government responsibilities are fully and effectively represented in Northern Ireland. We are the centre of expertise on Northern Ireland issues across Government. The Northern Ireland Office employs around 160 staff, with offices in Belfast and London. As a small Department, we adopt a flexible project-based approach to ensure that we have the right people, with the right skills, in the right place to support the delivery of our key objectives. Due to our structure and size, we are able to offer extensive exposure to Ministers and the opportunity to work on a far wider portfolio of policy and responsibilities than might be the case in a larger department. This creates an interesting and stimulating work environment. Our key priorities are set out in our Operational Delivery plan and include: Supporting greater inclusion, tolerance and openness in Northern Ireland Contributing to a safer Northern Ireland, where terrorist and paramilitary groups are less able to cause harm to communities Ensuring that governance in Northern Ireland is responsive, transparent and able to deliver effective public service. Addressing the legacy of the past in Northern Ireland For more information about what we do: Visit: About The Role: The NIO has a number of vacancies it is looking to fill at Grade 6 level including the following: Legacy Implementation & Sponsorship Deputy Head of Fiscal, Economy & Trade Head of National Security Policy and Strategy These are challenging, rewarding, and impactful Grade 6 roles which offer a unique opportunity to play a pivotal role in managing and developing the delivery of our departmental objectives. Working alongside a Deputy Director and Director, you will manage a core policy area, ensuring a high standard of support for Ministers across a range of competing priorities and demands. These roles sit at the heart of the Northern Ireland Office (NIO), requiring you to support a range of business priorities, engaging with various internal and external stakeholders, including officials across Whitehall and a variety of Northern Ireland based stakeholders. These roles will provide an unrivalled insight into the workings of the wider Department, Whitehall, and the operation of devolved government in Northern Ireland. The successful candidates will need to deliver effectively in a fast-paced and demanding area while also driving forward the wider departmental strategy. You will be responsible for leading a team of mixed grades, including direct line management of Grade 7s, with a key focus on building team capability and culture, and supporting the Deputy Director in managing team resources. We are looking for a proven, effective, and inclusive leader who is passionate about the work of the NIO. You will champion diversity, motivate your high-performing team to be curious, innovative, and impactful, and generate a shared culture and vision. Candidates must have experience working in fast-paced environments, coordinating across multiple teams, and demonstrate excellent judgement, strong communication and influencing skills, a good sense of the wider political context, and excellent stakeholder management. Duties And Responsibilities: The main responsibilities of the role include but are not limited to: Strategic Leadership and Policy Delivery:Provide effective leadership of the policy team, taking a strategic approach to policy commitments and implementation to deliver the NIOs departmental aims and the Secretary of States priorities. Ministerial Support and Advice:Ensure the team provides a first-class service to Ministers, enabling collaboration and the provision of accurate, timely advice. Corporate Leadership and Culture:Play an active role as a grade 6 in terms of role modelling leadership and management behaviours, championing diversity, inclusion, and wellbeing across the department. Stakeholder Engagement and Partnership:Build strong partnerships with key stakeholders, including other Whitehall and NI departments, and credibly represent the views of Ministers and senior officials. Team Management and Development:Working alongside the DD develop and maintain a high-performing and busy team, focusing on the management and development of staff to ensure everyone reaches their full potential. Cross-Departmental Collaboration:Work with a range of stakeholders to progress government priorities, including leading strategic projects, by maintaining a strong, trusted network across the NIO, Northern Ireland, and other departments. Essential Criteria: The post holder will need to demonstrate the following in their application and at interview: Excellent leadership skills with experience of delivering challenging objectives under intense scrutiny whilst managing your own and teams resilience/wellbeing ; Excellent judgement and analytical skills, the ability to make evidence based recommendations and decisions; Excellent communication and influencing skills to influence a wide variety of stakeholders at different levels; The ability to present and communicate complex information and recommendations to senior decision makers in a clearly and impactful manner, including through high-quality drafting under pressure; Strong partnering and collaborating skills, and the ability to build strong relationships with a diverse range of stakeholders to support effective delivery of strategic outcomes; and Desirable Criteria: Understanding of the political and security environment in Northern Ireland; Experience working on legislation, policy, projects or programmes in Northern Ireland or Whitehall; Existing security clearance (Some of the roles will require Developed Vetting clearance. Applicants should already hold DV clearance or be willing to acquire it) Behaviours: We will assess you against the following Success Profiles behaviours at the Grade 6 level during the application sift: Leadership Making Effective Decisions In addition, we will assess against the following behaviours at interview stage: Leadership Making Effective Decisions Communicating and Influencing Delivering at Pace Experience: Please provide a CV or work history and statement of suitability no longer than 1000 words outlining how you meet the essential and desirable criteria. Both will be used in order to assess any demonstrable experience, career history and achievements that are relevant to the role. Your statement of suitability needs to set out evidence of how your experience meets the essential and desirable criteria set out above. Your layout is entirely your preference; you may choose narrative, bullets, etc. One narrative example may cover the requirements needed. You dont have to explain the whole process, just what you have done and the skills and experience you have used. Share with us what makes you suited to this role and why. What you can do, the skills you have that are transferable and the life experience or passion you have that are linked to this role. If you dont have work-based examples then give examples from school/college, clubs, volunteering or other activities you have been involved in. You will also be asked to complete a CV with details of your education, professional qualifications, previous skills and full employment history. Your CV will not be formally assessed so please put the main evidence of your skills into your personal statement. Your CV will be used to add context to your personal statement. More information on behaviours and success profiles can be found here. Please note that in the event of a large number of applications being received we may run the initial sift on the lead of Leadership. Expected sift date 25th May Expected interview date/s week commencing 8th June Interview location - Your interview is expected to be conducted face to face, however there may be occasions where this will change. You will be notified of the location if you are selected for an interview. Interview: You will be assessed against the same behaviours at the interview stage and will be asked to provide examples of how you have demonstrated the behaviours. In addition, you will also be asked strength based questions. It may help to use one or more examples of a piece of work you have completed or a situation you have been in and use the WHO or STAR model to explain: WHO - What it was? How you approached the work/situation? What the Outcomes were, what did you achieve? Or STAR - What was the Situation? What were the Tasks? What Action did you take? What were the Results of your actions? Strengths It is difficult to prepare for strength type questions. However, you can think through your answers, focus on your achievements and aspects you enjoy and decide how these can be applied in the organisation and role. While strengths questions are shorter and we do not expect a full STAR response, the panel is interested in your first reaction to the question and information or reasoning to support this. Further information on Civil Service Strengths can be found here. If you do not have work-based examples then please give examples from school/college, clubs, volunteering or other activities you have been involved in. All applications for employment are considered strictly on the basis of merit. Offer Once all interviews have been completed, you will be notified of the outcome by email. Offers will be made in strict merit order to the highest scoring candidate first. The successful candidate will be notified of a start date following successful security checks. Additional information received after the closing date will not be considered. Failure to provide sufficient information in support of an application prior to the closing date will not be considered as grounds for an appeal if an applicant is not shortlisted for interview. Security Clearance: This role requires National Security Vetting given the access to sensitive information afforded by the job role. You can find more information by reviewing the information held in the following links: United Kingdom Security Vetting: Applicant - GOV.UK ( The vetting charter - GOV.UK ( In addition, there is a minimum UK residency requirement set by the Cabinet Office which is dependent on the security level required for the role. This role requires SC and to be eligible to apply for this role you should have been present in the UK continuously for the past 5 years. Depending on the role you are placed into you may also be required to undertake the DV process. Neither Detached Duty terms nor relocation costs will apply to this post. Further Information: Further information about the post may be obtained from Clare Sloan via email to . All applications for employment are considered strictly on the basis of merit. This job description should not be taken as constituting conditions of employment. Please note that due to the high interest in NIO opportunities, feedback cannot be given if you are unsuccessful at the sift stage. Feedback is available on request if unsuccessful following the interview. Complaints: The Civil Service Code sets out the standards of behaviour expected of civil servants. Appointment to the Civil Service is governed by the Civil Service Commissions Recruitment Principles. You have the right to complain if you feel a department has breached the requirement of the Recruitment Principles. Please contact SSCL () in the first instance. If you are not satisfied with the response, you may bring your complaint to the Commission. For further information on bringing a complaint to the Civil Service Commission please visit their web pages: Reserve Lists: In the event that the advertised post following interview, identifies more appointable applicants than available posts, we may hold applicant details on a merit/reserve list for a period of 12 months from which further future appointments can be made. Candidates placed on a reserve list will be informed of this. Those candidates who do not wish to remain on the reserve list should contact to be removed from the reserve list. Interview dates Dates week commencing 8th June Contact information If you require any assistance please call (Monday to Friday 8am - 6pm) or e mail Additional Information Working Arrangements & Further Information The MoJ offers Hybrid Working arrangements where business need allows. This is an informal, non-contractual form of flexible working that blends working from your base location, different MoJ sites and / or from home (please be aware that this role can only be worked in the UK and not overseas). All employees will be expected to spend a minimum of 60% of their working time in an office, subject to local estate capacity. Some roles will not be suitable for Hybrid Working. Similarly, Hybrid Working will not suit everyones circumstances. Arrangements will be discussed and agreed with the successful candidate(s) and subject to regular review. For nationally advertised role: all successful candidates will be appointed to the nearest viable office nearest to their home postcode and on its respective pay scale. This will be at either a HQ building (subject to desk allocation, a Justice Collaboration Centre (JCC) or a Justice Satellite Office (JSO) See Map. All employees will be expected to spend a minimum of 60% of their working time in an office, subject to local estate capacity). For current MoJ employees, your base location will need to be changed to the nearest viable office (to your home postcode), either at a HQ building, JCC or JSO within the National Office Network and moved its locations respective pay scale (any legacy arrangements/locations will need to be amended). Some of MoJs terms and conditions of service are changing as part of Civil Service reform. The changes will apply to staff joining MoJ who are new to the Civil Service. Staff joining MoJ from other civil service employers will transfer onto the new MoJ terms if they are already on 'modernised' terms in their current post or onto 'unmodernised' MoJ terms if they are on 'unmodernised' terms at their current post. Details will be available if an offer is made. MoJ candidates who are on a specialist grade, will be able to retain their grade on lateral transfer. All candidates who are currently in receipt of Mark Time / Pay Protection should ensure they are familiar with the new policy on permanent and temporary promotion which can be found on the employee intranet. Flexible working hours The Ministry of Justice offers a flexible working system in many offices. Standard full time working hours are 37 hours per week. MoJ welcomes part-time, flexible and job-sharing working patterns, where they meet the demands of the role and business needs. All applications for part-time, flexible and job-sharing working patterns will be considered in accordance with the MoJs Flexible Working policy. Benefits The MoJ offers a range of benefits: Annual Leave Annual leave is 25 days on appointment and will increase to 30 days after five years service. There is also a scheme to allow qualifying staff to buy or sell up to three days leave each year. Additional paid time off for public holidays and 1 privilege day. Leave for part-time and job share posts will be calculated on a pro-rata basis. Pension The Civil Service offers a choice of pension schemes, giving you the flexibility to choose the pension that suits you best. Training The Ministry of Justice is committed to staff development and offers an extensive range of training and development opportunities. WHJS1_NI

Your mission JOB TITLE: Business Transformation Project Manager JOB LOCATION: Belfast, hybrid working with a requirement to be onsite 2 days per week as and when required depending on experience and project specific requirements TERMS: UK right to work required (no sponsorship available), fixed term contract for 12 months (Maternity Cover) THE JOB Are you an experienced Change Project Manager and wanting to flex your talents in Business Improvement. Do you enjoy using your planning and influencing skills to achieve your organisation's compliance goals? As a Change Project Manager you will collaborate with all areas of the business to deliver our aspirations. Your profile WHAT WILL YOU BE DOING? • Working collaboratively with internal and external stakeholders, at all levels within the organisation, to define and achieve mutual understanding of the project scope., • Work with the team to identify and schedule all the work required to fulfil the scope, building a detailed project plan to track progress., • Perform a gap analysis to determine state of processes and procedures., • Identify integration points between systems and processes and understand the impacts changes will have., • Work closely with SMEs to define business benefits and return on investment., • Develop project plan to address gaps in processes and procedures, • Demonstrate need to remove inefficient practices Establish Documented Procedures, • Embed Quality Culture, • Plan the project(s) in sufficient detail to ensure integration of all activities, identification of cross-portfolio dependencies, and understanding of critical paths and key milestones, • Ensure non-people resources are identified so that the project budget will be accurate and remain in line with the agreed Business Case, • Ensure all necessary cross-functional resources are identified and ensure that all resources understand their roles and accept their responsibilities by developing a RACI., • Provide day-to-day management for the project - time, cost and quality in line with Fibrus PMO processes., • Ensure there is a robust process in place for risk and issue management instigating mitigation actions and identifying contingency plans to keep the project on track, • Using appropriate systems, tools and techniques, establish and manage an effective project reporting structure to measure and track project performance, • Leading our procurement schedule, making sure the right suppliers are engaged for each project. WHAT WILL YOU BRING?, • Proven experience as a Change Project Manager, delivering complex technical projects in a fast-paced environment, delivering on time, within budget, and to the highest quality standards., • Have experience in delivering Business change processes with or without technology changes, • The ability to identify key dependencies between projects, managing integration points and associated impacts, to ensure there are no negative impacts on the business., • The ability to manage and lead multiple software development-based projects, and workstreams, simultaneously. You will be responsible for planning and overseeing projects and ensuring their successful delivery. Direct experience of managing and supporting business improvement processes., • Excellent project management skills, including experience with project planning, risk management, benefits management and stakeholder management., • Strong technical knowledge and experience of software development processes and methodologies., • Experience of different project management approaches e.g. agile and waterfall, • Outstanding communications and interpersonal skills to establish effective working relationships with all key stakeholders, at all levels., • The ability to influence without authority., • Able to rapidly analyse client situations and tailor appropriate responses to fit., • Able to think commercially, whilst also able to see where to add value., • Committed to producing quality outputs down to the finest details, including impeccable documentation formatting and presentation., • Demonstrate resilience during change and continue delivery., • High-level of IT literacy, proficient user of Microsoft Office tools and MS Project, • Able to solve problems in a measured and creative way. WHJS1_NI

JOB VACANCY Contracts support executive (Ref: CSE/05/26) Permanent / Full time Position (37.5/hrs per week) Hours 9.00 am - 5.00 pm Monday to Friday Location: Duncrue Street, Belfast Competitive Salary & Benefits Purpose of the Job The Contracts Support Executive will work closely with and provide administrative support to the Senior Contracts Manager, taking ownership for key administrative tasks in order to maintain and build on the excellent relationships that the Company has developed with its key customers. Key Responsibilities and Accountabilities Acting as a lead point of contact for our leading clients, building and maintaining good relationships, whilst maintaining high levels of professionalism at all times Taking ownership key contracts and handling client enquiries /complaints/ and requests through to resolution in the first instance, and where necessary, escalating to the appropriate Contract Manager Data Entry - Updating Contracts and Agreements with all relevant information, including pricing. Ensure all files / contracts / records are maintained in a timely and accurate manner and stored in line with our GDPR obligations Assisting the Senior Contracts Manager in the preparation of contracts/reporting, service level agreements and attending client meetings. Producing documents, reports & presentations for key clients Provide weekly and monthly reports to the Senior Contracts Manager. Communicate contractual changes to customers, as required Managing the day-to-day diary of the Contracts Management Team, organising customer/client visits and audits as required Carry out Customer site audits and any other reasonable tasks required by the Senior Contracts Manager Participate in training and personal development activities Be flexible in undertaking the duties and responsibilities attached to your role, carrying out any other reasonable tasks as required by Management Essential criteria To be considered for this role, you should display the following: At least 1 year's previous Administration experience Excellent organisational skills Ability to work well under pressure, to meet project deadlines Excellent communication skills both verbal and written Excellent working knowledge of Microsoft office including Word, Excel and PowerPoint Able to prioritise effectively and is results driven Must be self-motivated; can work on their own initiative as well as part of a team Must be able to provide documentation to confirm their eligibility to work in the UK Desirable Criteria Previous administrative experience working in a Customer Service / Sales Administration environment (minimum of 1 year) would be advantageous Previous experience/knowledge of the waste industry What We Offer! Competitive salary & Performance Bonus Opportunities for personal growth and development Eligible for Company Sick pay and DIS benefit after one years' continuous service Eligible for Private Healthcare Scheme & Cash Health Benefit (upon successful completion of probation) 33 days annual leave including Bank holidays Hybrid working upon successful completion of probation Company pension scheme Excellent location outside of Belfast City Centre and with free onsite parking Closing Date: 20th May 2026, 5 pm To be considered for this role you will be redirected to and must complete the application process on our careers page. To start the process, click the Apply button below to Login/Register.

Company description We believe in the power of ingenuity to build a positive human future. As strategies, technologies, and innovation collide, we create opportunity from complexity. Our teams of interdisciplinary experts combine innovative thinking and breakthrough technologies to progress further, faster. Our clients adapt and transform, and together we achieve enduring results. We are over 4,000 strategists, innovators, designers, consultants, digital experts, scientists, engineers, and technologists. And we have deep expertise in consumer and manufacturing, defence and security, energy and utilities, financial services, government and public services, health and life sciences, and transport. Our teams operate globally from offices across the UK, Ireland, US, Nordics, and Netherlands. PA. Bringing Ingenuity to Life. Job description We believe in the power of ingenuity to build a positive human future. We challenge where it matters and own the outcome. We combine strategic thinking, customer-centric service design, and agile engineering practices to accelerate innovation in a tech-driven world. Why consider joining our Digital & Data community? ?? Join our Digital & Data team working alongside product, design and a wide range of other experts and cross-disciplinary teams to bring ideas to life through innovative software solutions. Grow a flexible and unique career within a trust-based, inclusive environment that values excellence, innovation, and curiosity. You have the option to progress with us on a technical career track. No need to go onto the Partner career track if this doesn't align with what you want to do. Hybrid working - our approach is to be in the office or on client site a minimum of 2 days per week. Work on a broad variety of projects and tech stacks for clients across seven sectors - no project is ever the same Join other experts within our supportive and collaborative tech community through knowledge-sharing and peer-level support, coaching and mentoring Deepen your expertise through our culture of learning and growth - you'll have budget to take courses (technical and non-technical training), plus gain certifications Our tech stack ?? While we advocate for using the right tech for the right task, you can expect to work with the following technologies to ensure scalable, high-performance applications: Programming Languages: Java, Java OOPS, Java 8 Cloud technologies: AWS What you can expect ?? Work to agile best practices and cross-functionally with multiple teams and stakeholders. You'll be using your technical skills to problem solve with our clients, as well as working on internal projects Live in-person whiteboarding sessions to problem solve as a team, alongside asynchronous communication on Teams Hybrid working with the team on client site or in our office a minimum of two days per week. However, the actual time you spend and where you spend it will vary by role or assignment, including up to 5 days per week on a client site. An environment that deeply cares about its values Values | PA Consulting Qualifications Essential requirements Even if you don't meet every requirement below, feel free to still apply as we are often hiring for similar roles which your background might be better suited to. Minimum of 2 years' experience in Java software development Deep understanding of multi-threading concepts and performance optimisation. Proven ability to design, implement, and deliver complex software solutions. You thrive in problem-solving and analytical thinking You enjoy collaborating with multiple stakeholders in a fast-paced environment Please be aware that some of our UK roles at PA Consulting require a UK security clearance. All PA people are required to undergo background checks and to achieve the Baseline Personnel Security Standard however, some UK roles also require higher levels of National Security Vetting, where applicants must have at least 5 years of continuous residency in the UK. We therefore ask that you only apply if you meet the residency requirements (i.e. you are a British citizen or have been resident in the UK for the past 5 years), as this is the prerequisite for a security clearance. If you're unsure about your eligibility, we encourage you to review the UK Government's guidance on security vetting before applying. #LI-SG1 Additional information Assessment process Please note that the interview stages may be subject to change based on the specific requirements of the role. Quick call with one of our Tech Recruiters - to discuss your application, the role and PA Round 1: Either a competency or technical interview (60 mins) Round 2: Either a competency or technical interview, whichever you didn't do at first round (60 mins) Final round ??: Meeting with a PA leader - a mini case study and discussion around your client-centricity (60 mins) Life At PA encompasses our peoples' 's about how we enrich peoples' working lives by giving them access to unique people and growth opportunities and purpose led meaningful work. Our purpose guides how we work with our clients and our teams, and support our communities, to deliver insight and impact, solving the world's most complex challenges. We're focused on building a workplace that values human difference and diverse mindsets, and a culture of inclusion and equality that unlocks the potential in our people so everyone can be their best self. We are dedicated to supporting the physical, emotional, social and financial well-being of our people. Check out some of our extensive benefits: Health and lifestyle perks accompanying private healthcare for you and your family 25 days annual leave (plus a bonus half day on Christmas Eve) with the opportunity to buy 5 additional days Generous company pension scheme Opportunity to get involved with community and charity-based initiatives Annual performance-based bonus PA share ownership Tax efficient benefits (cycle to work, give as you earn) We're committed to advancing equality. We recruit, retain, reward and develop our people based solely on their abilities and contributions and without reference to their age, background, disability, genetic information, parental or family status, religion or belief, race, ethnicity, nationality, sex, sexual orientation, gender identity (or expression), political belief, veteran status, any other range of human difference brought about by identity and experience. We welcome applications from underrepresented groups. Adjustments or accommodations - Should you need any adjustments or accommodations to the recruitment process, at either application or interview, please contact us on To be considered for this role you will be redirected to and must complete the application process on our careers page. To start the process, click the Apply button below to Login/Register. WHJS1_NI

The Company Our client is a well-established, values-driven organisation within the social sector, committed to delivering high-quality, person-centred services across Northern Ireland. The Role The People Operations Coordinator will provide essential HR support across a broad range of employee relations and administrative activities. Working closely with the HR Manager and HR Adviser, this role will ensure the efficient delivery of HR processes, with a strong focus on accuracy, compliance, and high-quality service. Key responsibilities include: Provide comprehensive HR administrative support across the People Operations function Act as a first point of contact for HR queries, ensuring accurate information is provided or escalated appropriately Coordinate the full administration of the absence management process, including documentation, return-to-work procedures, and identifying trends or issues Manage the leavers process end-to-end, including documentation, system updates, and feedback collection Administer employment contracts, including amendments and variations Support annual leave processes, including calculations and loyalty award schemes Maintain accurate HR and payroll data, ensuring all records are up to date and compliant Support safer recruitment processes, including Access NI applications and monitoring Assist with recruitment administration as required Provide administrative support for employee relations processes, including investigations, disciplinary and grievance procedures Undertake accurate and timely note-taking in formal HR meetings and hearings Produce reports and analyse HR data, identifying trends and areas of concern Contribute to HR reporting requirements, including quarterly reports and external submissions (e.g. ONS) Support Subject Access Requests, ensuring documentation is collated and processed appropriately Maintain confidential employee records in line with GDPR requirements Support audit and compliance activities across the HR function Promote equality, diversity, and inclusion in line with organisational policies The Person Essential Criteria: CIPD Level 3 qualified (minimum) or working towards, or a relevant third-level qualification Previous experience in an HR or people operations role Full UK driving licence and access to own vehicle Strong IT skills, including Microsoft Office (particularly Excel and Word) Ability to input, analyse, and verify data with a high level of accuracy Excellent attention to detail and organisational skills Proven experience in note-taking and producing high-quality documentation Ability to manage a varied workload and meet deadlines with minimal supervision Strong written and verbal communication skills Customer-focused approach with the ability to build effective working relationships Desirable Criteria: Experience supporting employee relations processes such as disciplinary, grievance, or investigations Knowledge of HR systems and databases Experience working within a regulated or compliance-driven environment Understanding of employment legislation and HR best practice Package & Benefits Hybrid or flexible working options Pension contribution Ongoing training and development opportunities Supportive and collaborative working environment How to Apply To apply for this role, submit your CV via the application form provided. Alternatively, to speak in absolute confidence about this opportunity please contact Zeena Jackson via . Disclaimer If you have a disability which means you require assistance at any stage of the recruitment process, please contact us directly to discuss. Honeycomb is committed to providing equality of opportunity to all. Please note, we are receiving an exceptionally high number of applications at present and will be unable to shortlist candidates who are not meeting the specific requirements for this role. Due to the high volume of applications, we may be unable to provide individual feedback. We thank you in advance for your understanding. This position is subject to an Enhanced criminal record check through AccessNI. A criminal record will not necessarily be a bar to obtaining the position. Benefits: Hybrid Working WHJS1_NI

A well-established accountancy practice in Belfast is looking to appoint a Payroll Administrator to support its busy payroll bureau. This is a strong opportunity for someone with early payroll experience to join a collaborative team, gain exposure to a varied client base, and broaden their skill set across payroll, bookkeeping, and accounts. You will play a key role in ensuring the smooth delivery of payroll services while working closely with experienced professionals in a supportive environment. Benefits * Competitive salary * 36.5-hour working week * 22 days annual leave plus 11 statutory holidays * Employer pension contributions * Early finish at 2pm every Friday About You * 12 years experience in a practice or payroll bureau environment * Experience with HSC payroll is desirable * Working knowledge of payroll software * Competent in Microsoft Excel and Word * Strong written and verbal communication skills * Ability to prioritise workload and meet deadlines * High level of accuracy and attention to detail * Willingness to support wider team activities and develop new skills About Your New Role Always * Process payroll for a portfolio of clients, ensuring all deadlines are met * Prepare and submit employer reports accurately and on time * Maintain a high standard of accuracy and quality in all work Often * Support the Payroll Manager in the day-to-day running of the payroll bureau * Liaise with internal teams and external client contacts * Assist with additional client reporting requirements Occasionally * Support other departments across the firm as required * Assist with ad hoc assignments from Managers and Partners * Gain exposure to bookkeeping and accounts work Never * Be limited to one area without the opportunity to develop broader experience * Give a lion a perm. WHJS1_NI

Honeycomb is delighted to be partnering with a well-established East Belfast law firm in the search for a Legal Administrator / Legal Secretary to join their growing team. The Opportunity This is an excellent opportunity for someone looking to build a long-term career within the legal sector. The successful candidate will provide comprehensive administrative and secretarial support within a busy office environment. Full training will be provided, making this an ideal role for someone looking to gain experience in the legal industry, although previous legal experience would be advantageous. About the Firm This respected East Belfast firm has developed a strong reputation for providing professional and client-focused legal services across Northern Ireland. The practice prides itself on maintaining a supportive and collaborative working environment, with a strong focus on staff development, professionalism, and high standards of client care. Salary & Benefits • Competitive salary DOE, • Generous annual leave entitlement, • Pension contribution, • Ongoing training and development opportunities, • Supportive team environment Key Responsibilities • Preparing, formatting, and reviewing legal documents and correspondence, • Organising and maintaining client files, ensuring records are accurate and up to date, • Audio typing and transcription as required, • Managing incoming calls, emails, and correspondence professionally, • Providing day-to-day administrative support to solicitors and the wider team, • Assisting with case preparation and file management, • Liaising professionally with clients and third parties, • Managing workloads effectively and prioritising tasks within a busy office, • Maintaining a high standard of professionalism and client service at all times About You • Previous experience within an administrative, secretarial, or office support role is desirable, • Previous legal experience is advantageous but not essential, as full training will be provided, • Strong organisational skills with excellent attention to detail, • Excellent written and verbal communication skills, • Ability to manage a varied workload and meet deadlines, • Proficient in Microsoft Office and general IT systems, • A professional, reliable, and proactive approach, • Ability to work independently and as part of a team For a confidential discussion about this opportunity, please submit your CV via the link or contact Caoimhe Fairfield at Honeycomb directly: Email: Tel: If you require any adjustments during the recruitment process, please let us know and we will be happy to assist. Honeycomb is an equal opportunity employer. If this role is not quite right for you, feel free to get in touch or visit our website to explore other current opportunities. Skills: legal secretary law admin administrator legal office WHJS1_NI

The Cedar Foundation is seeking to recruit the following position: Ref 26-092-FM-CS-WEB Job Role Facilities Manager Location Head Office, 1 Ravenhill Reach, Belfast, BT6 8RB Agile Working Option / Working from Home Salary Starting on £43,024 per annum (pro rata) Contract Fixed Term Contract (18 months) Hours 37 Hours per Week Monday - Thursday (9-5pm) Friday (9-4.30pm) The successful candidate will benefit from flexitime The Role The Facilities Manager is responsible for ensuring that all Cedar properties are safe, compliant, well-maintained, and fit for purposes. This includes office premises, training/resource centres, residential care settings, and supported living environments. The role spans a diverse property portfolio comprising buildings owned by the charity, housing associations, and private landlords where Cedar staff have a base location. The postholder will ensure high standards of health and safety, regulatory compliance, maintenance, and operational efficiency while supporting developmental work to improve premises and support service delivery for staff and service users. Benefits • Starting on 23 days annual leave pro rata plus Cedar recognises 12 statutory days., • Annual incremental pay increases on a point salary scale., • Auto-enrolment pension through Standard Life. Employer contribution 4%, employee contribution 5%., • Occupational sick Pay Scheme increases with length of service., • Investor in People Platinum accredited organisation with commitment to development of the staff team through training and learning opportunities., • Staff recognition & reward incentives aligned to high standards of performance., • Working from home and agile working benefits., • Flexi-time policy., • Cycle to work scheme., • Health Cashback scheme (including access to 24/7 Doctor's Line & counselling services)., • Special offers at over 600 leading high street and online retailers. Essential Criteria, • Proven experience in facilities or property management across multiple sites., • Experience managing contractors and service providers. #nijobs To be considered for this role you will be redirected to and must complete the application process on our careers page. To start the process, click the Apply button below to Login/Register. WHJS1_NI

VANRATH are delighted to be working in partnership with a leading specialist accountancy firm to recruit a Payroll Administrator. This is an excellent opportunity to join a highly respected practice with a strong reputation in the medical sector, offering a supportive team environment and clear scope to broaden your experience across payroll, bookkeeping and accounts. The Role You will play a key role within the firm's payroll bureau, supporting a varied client portfolio and ensuring payrolls are processed accurately and on time. This position offers strong exposure to client-facing work, alongside the opportunity to develop wider practice experience over time. What You Will Do Administer payroll for a portfolio of clients, ensuring all deadlines are met Prepare and submit all employer reports in line with statutory requirements Support the Payroll Manager in the smooth day-to-day running of the payroll bureau Assist with additional client reporting requirements Maintain a high level of accuracy and attention to detail across all work Liaise with both internal teams and external clients to resolve queries Support other areas of the firm where required, including ad hoc assignments Gain exposure to bookkeeping and accounts work as your experience develops What's in It for You Competitive salary package 36.5-hour working week Early finish at 14:00 every Friday 22 days annual leave plus 11 statutory holidays Employer pension contributions Supportive and collaborative working environment Requirements Minimum 1-2 years' experience in practice or a payroll bureau environment Experience of HSC payroll (desirable) Working knowledge of payroll software Strong proficiency in Microsoft Excel and Word Excellent written and verbal communication skills Strong organisational skills with the ability to prioritise workload effectively What's the next step? If you think this role may be of interest to you, or you wish to discuss any other senior accountancy jobs in Northern Ireland, please apply via the link below or contact Emma Jayne Bowen at VANRATH or on LinkedIn in the strictest confidence. Why VANRATH will help you secure your next role: Established in 2000, VANRATH has become a market leader in Northern Ireland. This success is a direct result of our dedication to confidentiality, professionalism, and the wealth of knowledge held by our Senior Consultants. VANRATH has a proven record of pairing the best local talent with leading businesses. Skills: payroll accountancy team assistant Benefits: early finish friday WHJS1_NI

Field Service Engineer - Co. Down Permanent | Full-time | Field-Based The Company Our client is an established supplier of specialist industrial and construction equipment, supporting customers across Ireland with high-quality tools, service, and technical expertise. Known for their strong customer relationships and commitment to reliability, they operate in demanding site environments where uptime and technical support are critical. Due to continued growth, they are now seeking a Field Service Engineer to join their team, covering all 32 counties of Ireland , with the role advertised from County Down . The Role The successful candidate will provide on-site technical support to customers nationwide, carrying out servicing, diagnostics, and repairs on specialist construction and industrial tools. This is a field-based role involving regular travel across Ireland, including overnight stays as required. Key responsibilities include: • Diagnosing, repairing, and servicing power tools at customer sites across Ireland, • Carrying out scheduled maintenance for key customer accounts, • Providing technical advice and basic training to customers on correct tool usage, • Completing service reports and maintaining accurate repair records, • Managing spare parts used during field repairs The Candidate Our client is seeking a hands-on technical professional with: • Experience repairing or servicing power tools, construction equipment, or industrial machinery, • Strong mechanical aptitude (mechanics will be considered), • Basic electrical or electronic fault-finding ability, • Willingness to travel extensively throughout Ireland, • Full UK driving licence, • Strong time-management skills and ability to work independently Package Our client offers a comprehensive and attractive package, including: • Salary: £40,000 - £45,000, • Bonus: Up to £3,500, • Vehicle: Company van provided, • Tools & Equipment: Fully provided, • Training: Full technical and product training, • Pension: 6% company contribution, • Healthcare: Healthcare package included We recruit within the Industrial, Manufacturing, Construction, IT, Engineering, and Corporate markets. Please call our consultants to arrange an interview. We have many other roles available, so feel free to contact Ross Wilkinson to discuss how we can help you! Skills: drills tools tooling hire down armagh Benefits: vehicle healthcare pension bonus WHJS1_NI

Country Manager - Specification Sales Territory: Ireland Salary: Up to £65,000 + £10,000 Bonus | £600 p/m Car Allowance | Pension THE COMPANY: Our client is a well-established international manufacturer with a strong brand presence across the construction sector. Known for their high-quality, design-led products, they work closely with architects, designers and commercial partners on premium projects across Europe. With significant growth plans for Ireland, they are now looking to appoint a Country Manager to take full ownership of the market and drive expansion. THE ROLE: This is a highly autonomous, strategic sales role, where you will be responsible for growing the Irish market. Initially, the focus will be heavily weighted towards new business development, building relationships and winning specifications across the construction sector. Over time, as the business grows, you will have the opportunity to build and lead your own team, shaping the future of the brand in Ireland. You will be selling a range of specialist interior finishing products for kitchens and bathrooms, engaging with architects, interior designers, developers, merchants and end users. This is a specification-led sales process, working on projects from early design stages through to completion, requiring strong commercial awareness and the ability to influence multiple stakeholders. THE PERSON: We are looking for a proven specification sales professional with experience in the interiors sector. The ideal candidate will have: * A strong background in specification sales, working with architects and interior designers * Experience within interior finishing products (kitchens, bathrooms, surfaces, fittings, etc.) * A track record of developing new business and growing a territory * Strong commercial acumen and the ability to manage long sales cycles * The ambition and capability to step into a future leadership role * A professional, driven and self-sufficient approach This is not suited to candidates from external building envelope products - experience within interior finishes is essential. THE PACKAGE: * Base Salary: Up to £65,000 * Bonus: £10,000+ * £600 per month car allowance plus fuel card * Pension, healthcare, income protection, 25 days leave This is a rare opportunity to take ownership of an entire country market, with the backing of a strong international brand and a clear pathway into leadership as the business scales.

Plumbmaster is a specialist division of Haldane Fisher, supplying high-quality plumbing and heating materials to the construction industry across Northern Ireland. We are known for our technical expertise, dependable service, and strong relationships with trade customers. We are currently recruiting a Counter Sales Advisor to join our Ladas Drive Plumbmaster branch. This is an excellent opportunity to build a long-term career within a successful and growing specialist merchant, offering a stable working environment and strong development and progression opportunities. Key Responsibilities Provide outstanding customer service at the trade counter Advise customers on plumbing and heating materials and product solutions Process sales transactions accurately using tills and internal systems Pick, pack, and prepare customer orders safely and efficiently Maintain a clean, safe, and well-organised branch environment Support stock control, merchandising, and teamwork across the branch Identify sales opportunities and support customers with technical product queries About You Strong communication skills with a professional, customer-focused approach Ability to build and maintain positive working relationships with customers Experience in a fast-paced customer service or trade counter environment Good knowledge of plumbing materials and products (or the ability and willingness to develop this knowledge) Proactive, reliable, and sales-minded with strong attention to detail Forklift licence desirable but not essential (training can be provided) What We Offer Competitive rate of pay Staff discount scheme Comprehensive in-house training and development Incentive bonus scheme Contributory pension scheme 30 days annual leave (inclusive of public holidays) Healthcare Cash Plan (Westfield Health) A supportive, team-focused environment with genuine career progression opportunities To be considered for this role you will be redirected to and must complete the application process on our careers page. To start the process, click the Apply button below to Login/Register. WHJS1_NI

The Vacancy Youth Facilitator- South Eastern Trust Inspire is proud to partner on the Peace of Mind project - a cross-community, cross-border initiative funded by the PEACEPLUS Programme, managed by the Special EU Programmes Body (SEUPB). Are you passionate about youth work, mental health, and creating real, inclusive change in your community? Do you want to use your skills to support young people aged 14-25 to build confidence, resilience, and emotional wellbeing in a safe, creative environment? If so, you could be the Youth Facilitator we're looking for to join Inspire's Peace of Mind team. Vacancy Details Location: South Eastern Trust Hours: 37 Contract: Fixed term temporary for a period of 20 Months until 31st March 2028 Base Location: Scrabowview Community Wellbeing Service About the Role As a Youth Facilitator, you will be responsible for delivering the Peace of Mind group programme across the full South Eastern Trust area, including Newtownards, North Down, South Down, Lisburn and Castlereagh working with young people from diverse backgrounds across Northern Ireland. This project takes an early intervention and prevention approach to support young people's mental health, wellbeing and personal development. You'll work in community settings, facilitating structured youth sessions, building positive relationships, and creating inclusive spaces where young people feel seen, safe, and supported. You'll also help co-design workshops, events and social action projects that explore identity, culture, and shared community experience, all rooted in the context of Northern Ireland's post-conflict legacy. Key Responsibilities: • Deliver engaging group-based programmes for young people aged 14-25, • Facilitate sessions on topics such as mental health, self-esteem, healthy relationships, identity and resilience, • Recruit and engage young people through community outreach and partnership work, • Collaborate with schools, youth organisations, and local agencies, • Embrace co-production- young people help shape everything we do What You'll Need:, • Minimum NVQ Level 3 (or equivalent), • At least 6 months' experience working with young people, families or minority groups, • Strong communication and facilitation skills, • Confidence in leading youth sessions and building group dynamics, • A full driving licence and access to a car (consideration given to disabled applicants), • Willingness to work evenings and occasional weekends, • Ability to register with NISCC upon appointment Skills and Experience:, • Background in youth work, health and social care, or community development, • Experience working with funded programmes and understanding reporting requirements, • Understanding of issues such as intergenerational trauma, deprivation, substance misuse, and mental health in post-conflict communities, • Familiarity with co-production, early intervention, and holistic wellbeing approaches, • Strong organisational and IT skills, including Microsoft Office Why Join Inspire & Peace of Mind? WHJS1_NI

Job Title: Class 2/HGV Driver Location: Belfast Bakery (BT12 6LP) Shifts: 10 day working fortnight on average 9.5 hours per day. So, whats it all about? As our next HGV Sales Driver, you'll be instrumental in safely delivering bakery products to customers. Your remit will be managing customer relationships and orders, loading orders onto lorries, conducting stock reconciliation, merchandising, and maximizing customer sales. Trust is crucial in this role as you will be responsible for the delivery of our bakery products to our customers. To excel in this role, you'll need to be reliable, have good communication skills, and be flexible. Accountability is key as you work to a tight schedule and interact directly with our customers. You're not the type to be shy and lazy, this isn't just a driving role as it requires the person to build relationships with our customers and sell our award-winning products. In this role, you will be well paid and offered opportunities for development. This role requires an individual who is motivated by building good relationships and interacting with others. As a Van Sales Driver, you are reliable, have good communication skills and are flexible. You would thrive on the chance to interact with our customers and be excited by the opportunities presented. Without drivers, our bakery products would not reach the shelves for customers. The Key Requirements... • C1/C Driving License, • CPC Card, • Tachograph Card, • Experience within FMCG or fast-moving goods distribution environment with some driving experience., • Knowledge of products and customer requirements, along with proven ability to build relationships with customers. Well provide you with opportunities to learn new skills, grow and develop and we aim to provide our colleagues with a job for life! We have many long-serving colleagues, some with over 30 years' experience with us. This opportunity is ideal for someone who enjoys working in a collaborative and fast-paced environment. Benefits baked in... All colleagues can choose from a wide range of benefits, heres a top crust taster of what we offer: • Competitive annual leave and flexibility where possible for a healthy work-life balance and recharge your batteries., • Three levels of pension schemes to suit your needs., • Aviva DigiCare+ Workplace App includes annual health checks, digital GP consultations, nutritional advice, and much more., • Hovis Choice benefits platform for everyday savings, cashback and much more., • Free on-site parking. At Hovis, we believe in embracing diversity and creating a welcoming workplace for everyone. Whether you're applying for a job or already part of our team, we promise to treat you with fairness, respect, and dignity. You will be valued and included here at Hovis. Does this sound like the right environment for you? If so, we would love to hear from you. To find out more about Hovis please visit our website and social media channels Benefits: Pension Fund Parking Paid Holidays WHJS1_NI

VANRATH are delighted to be partnering with a major company in Northern Ireland with the Recruitment of a Export Administrator to join a growing and dynamic company based in Belfast. This position is based in the company's Belfast office. Monday - Friday position. Hybrid working is available (80% in the office / 20% at home) - 37.5 hour week This is a Permanent position. This company has an excellent reputation. Salary £31,000 - £34,000 + other Additional Benefits (Top Company) + Fantastic work benefits and Environment + Holiday Package (25 days leave + Stats) & Progression Opportunities Key Responsibilities * Prepare and manage export documentation and oversee order administration for both domestic and international customers, from order receipt through to delivery, ensuring accuracy and compliance with all regulations. * Prepare, review and process Letters of Credit and other international trade documentation in line with regulatory and customer requirements. * Coordinate international shipments, working with logistics partners to optimise delivery while minimising risk and cost. * Compile, maintain and manage registration dossiers to support access to international markets. * Ensure accurate documentation and adherence to export compliance requirements. * Coordinate logistics activities to ensure efficient and timely shipment of goods. * Provide high-quality customer service and maintain clear communication with internal and external stakeholders. * Identify opportunities for process improvements to enhance operational efficiency. Essential Criteria * Minimum of 2 years' experience within the export industry. * Strong knowledge of international trade documentation, including Certificates of Origin, EUR1 forms and related export paperwork. * Excellent written and verbal communication skills, with the ability to communicate effectively at all organisational levels. * Strong organisational and time-management skills, with the ability to prioritise tasks and work effectively under pressure. * Exceptional customer service skills. * Highly motivated with a proactive approach to work. * Strong interpersonal skills and the ability to build effective working relationships. * Proficient IT skills, including standard Microsoft Office packages. * Full driving licence and access to a vehicle. For more information on this role please reach out to Jack Groves @ VANRATH for more information. The standard of dedication and expertise demonstrated by this team was unmatched. Jack was meticulous and encouraging, especially when it came to preparing for interviews and following up afterward. His detailed insight into what employers were seeking gave me a clear edge and eased much of the stress involved. That kind of commitment truly matters, and it was delivered without exception. Skills: Export Trade Logistics Transport Customs Administrator Customer Benefits: Work From Home Fantastic Benefits Package WHJS1_NI

Manager Safeguarding Location: Belfast (with travel across Northern Ireland as required; hybrid working policy in place) Salary: £36,294 per annum Contract: Permanent Hours: Full-time, 35 hours per week (evening and weekend work may be required at times to fulfil the obligations of the post) About the Organisation Charity Jobs NI is delighted to be exclusively partnering with Volunteer Now, Northern Irelands leading organisation promoting, developing and supporting volunteering. As an Investors in People Gold accredited employer, Volunteer Now offers flexible and hybrid working, alongside a supportive and inclusive environment where staff are encouraged to innovate and collaborate. Volunteer Now works across communities to promote volunteering, support organisations, and strengthen safeguarding practice for children, young people and adults at risk. Their safeguarding team delivers training, consultancy, and support services across Northern Ireland, Ireland, and the UK. The Role Volunteer Now is seeking an experienced and strategic Manager Safeguarding to lead and develop the organisations safeguarding function. This is a senior leadership role, responsible for shaping safeguarding strategy, driving high-quality training and support services, influencing policy development, and identifying opportunities for growth and business development. As part of the Leadership Team, you will play a key role in contributing to the overall strategic direction of the organisation. You will lead a specialist safeguarding team, oversee contracts and service delivery, and work with a wide range of stakeholders to promote best practice and ensure high standards across the sector. This role may also suit candidates who have worked as a safeguarding manager, safeguarding lead, head of safeguarding, safeguarding and quality manager, or safeguarding consultant. Key Responsibilities Provide leadership for Volunteer Nows safeguarding function, shaping strategy and service delivery Contribute as an active member of the Leadership Team, supporting organisational planning, decision-making, and performance monitoring Lead, motivate and develop a high-performing safeguarding team, including performance management and staff development Manage safeguarding contracts, services and training provision, ensuring high-quality delivery Identify and develop new business opportunities, including tenders, funding applications and partnership initiatives Strengthen relationships with statutory, community and voluntary sector partners Represent Volunteer Now externally, enhancing credibility and influence in safeguarding practice Monitor changes in policy, legislation and practice (including online safety) and adapt services accordingly Contribute to budget planning and financial management within the service area Promote and champion best practice in safeguarding and volunteering across the organisation About You You will be an experienced safeguarding professional with strong leadership capability and a strategic mindset. You will bring: A relevant third-level qualification or equivalent experience within the last 3 years Experience managing safeguarding cases, including making referrals and working with safeguarding agencies Proven experience managing teams, with strong leadership, planning and relationship-building skills Excellent communication and interpersonal skills Strong problem-solving and decision-making ability Excellent organisational and time management skills The ability to work at both strategic and operational levels A full driving licence and/or access to transport to meet the requirements of the role A social work qualification, training qualification, or leadership experience within a safeguarding context would be advantageous. Benefits Flexible and hybrid working arrangements Generous annual leave, rising with service (starting at 22 days plus statutory/public holidays) Pension contributions of 4.5% after probation Training and professional development opportunities Supportive, inclusive, and values-driven organisational culture How to Apply If youre ready to lead and shape safeguarding practice at a strategic level, wed love to hear from you. Simply apply now with your CV to register your interest. A member of the Charity Jobs NI team will be in touch to discuss your application and guide you through the next steps of the process. Closing Date: Monday 18th May 2026 at 12 noon Interviews: 29th May 2026 (subject to change) Volunteer Now is an Equal Opportunities Employer. Applications are particularly welcome from male applicants and individuals from minority communities who meet the criteria. This role requires an Access NI Basic Disclosure Check. Charity Jobs NI is proud to be the exclusive recruitment partner for this vacancy. Skills: Safeguarding Leadership Training

Sales Executive, Bangor £35,000 + Monday-Thursday 8:30am-5:00pm, Friday 08:30am-1:30pm (35 hr contract) We are working with a leader in their field to recruit for their new Sales Executive to join them in Bangor and as part of their commercial sales team play an important role in the development & delivery of business relationships within target targets, primarily into the American and European markets. The company are a global brand leader in the design & supply of products into the hair & beauty sectors and in this role you will; Drive repeat business and account growth by building strong client relationships Achieve sales targets, KPIs, and manage full account portfolios (pricing, products, promotions) Deliver persuasive product presentations and support new launches Maintain accurate CRM data, forecasts, and market insights Resolve issues efficiently to ensure high customer satisfaction Collaborate with internal teams (marketing, supply chain) and travel for business development What we are looking for 1 years+ sales experience, ideally with experience of either export sales or selling into the FMCG / beauty markets Excellent communication, negotiation and relationship building skills Ability to prioritise effectively and work to tight deadlines Confident IT skills Full, valid driving licence and willingness to travel as required In return you can expect an excellent package including flexitime, enhanced leave, staff discounts, pension plan plus exceptional progression and development opportunities. Skills: Sales Acumen Inter-departmental communication Negotiation WHJS1_NI

Artemis Human Capital is delighted to be exclusively partnering with a growing and well-structured business to recruit an Assistant Accountant to join their finance team. This is a broad, hands-on role offering a strong mix of month-end accounting and day-to-day finance operations , with real ownership of key processes. You will work closely with the Head of Finance, gaining excellent exposure across reporting, controls and operational finance, while also acting as a key support during periods of absence. This is an ideal opportunity for a part-qualified accountant or experienced Accounting Technician looking to step into a role with greater responsibility and visibility. Standout points: • Broad role combining management accounts and operational finance, • Direct exposure to and mentorship from Head of Finance, • Opportunity to take ownership of key finance processes, • Clear scope to develop and progress, • Flexible start times, • Strong benefits package including study support The Role This position blends traditional Assistant Accountant duties with responsibility for purchase ledger and wider finance operations. You will play a key role in supporting month-end close, maintaining financial controls, and ensuring the smooth day-to-day running of the finance function. Alongside this, you will act as a trusted support to the Head of Finance, helping to maintain continuity across finance operations. Key Responsibilities Financial Reporting & Month-End • Support monthly close processes including journals, accruals and prepayments, • Perform balance sheet reconciliations, • Assist in the preparation of management accounts, • Analyse variances and investigate discrepancies, • Take ownership of supplier invoice processing and reconciliations, • Prepare supplier payment runs, • Manage supplier queries and resolve discrepancies, • Oversee supplier setup and maintain accurate records, • Ensure compliance with internal controls and audit standards, • Support pricing query resolution for key customer accounts, • Provide support and cover for the Head of Finance when required, • Assist with prioritisation of workloads and issue resolution, • Contribute to maintaining smooth day-to-day finance operations, • Escalate risks and issues appropriately About You You will be organised, detail-driven and comfortable working across both transactional and accounting responsibilities. You enjoy taking ownership and are keen to develop your career within a structured finance environment. Skills & Experience Essential • Part-qualified accountant (ACA / ACCA / CIMA) or qualified Accounting Technician (IATI) with relevant experience, • Previous experience in an Assistant Accountant or similar role, • Strong understanding of month-end processes and reconciliations, • Experience across purchase ledger / transactional finance, • Strong Excel skills and systems experience, • Experience supporting audits and management accounts, • 34 days annual leave, • 5% employer pension contribution, • Flexible start times, • Study support (where applicable), • Supportive and development-focused environment Next Steps: To be considered share your cv or get in touch with Associate Director, Nicola McCallum who is shortlisting for the role Skills: Management Accounting Fixed Assets Month end WHJS1_NI

About Mitie Mitie Ireland is a leading facilities management, consultancy and professional services company. We offer a range of specialist services including technical services, security, cleaning, industrial cleaning, energy and sustainability, and professional consultancy. Our breadth and depth of services and expertise means that we can help to increase efficiencies, reduce costs, increase sustainability, and improve performance for our clients. We work with a wide range of private and public clients to create great work environments. At the 2025 Facilities Management Awards, our outstanding work was recognised with awards for Client and Service Provider, Best People Development and Excellence in Health & Safety. Mitie Ireland also won Facilities Management Company of the Year at the recent Chambers Ireland in Business Awards 2024. Mitie have been awarded the IBEC Keep Well Mark in and 2025 for our commitment to employee wellbeing and we have also been named in the Top 100 Employers for Wellbeing in Ireland. Mitie were the first FM company to achieve the KeepWell mark for employee wellbeing. We are proud of our diverse workforce and recognise our people through a number of reward and recognition schemes, as well as through our learning and tailored personal development We are Mitie, the future of high-performing places. Location: Belfast, UK Key Responsibilities: Greet clients and visitors with a positive, helpful attitude. Provide excellent customer service. Assisting clients in finding their way around the office. Announcing clients as necessary. Assisting with a variety of administrative tasks including copying, faxing, taking notes, and making travel plans. Preparing meeting and training rooms. Answering phones in a professional manner, and routing calls as necessary. Assisting colleagues with administrative tasks. Answering, forwarding, and screening phone calls. Sorting and distributing mail. Scheduling appointments. About You: Proven work experience as a Receptionist, Front Office Representative or similar role Proficiency in Microsoft Office Suite Hands-on experience with office equipment (e.g. fax machines and printers) Professional attitude and appearance Solid written and verbal communication skills Ability to be resourceful and proactive when issues arise Excellent organizational skills Multitasking and time-management skills, with the ability to prioritize tasks Company Benefits: • Annual leave purchase scheme (buy up to 5 extra days of annual leave per year)., • Free virtual GP service., • Access to our Employee Assistance Programme (EAP)., • Mi Recognition, • Talent Referral Scheme, • Long service awards, • Mi Deals (Fantastic savings at high street stores)., • Bike2Work Scheme., • Learning & development (access to 200 courses on our L&D platform). This job description is intended to give the post holder an appreciation of the role envisaged for this position and the range of duties undertaken. It does not attempt to detail every activity, and should be utilised as a general guide, detailing the minimum requirements and responsibilities of the position. Specific tasks and objectives will be agreed with the post holder following the appraisal process and on an as and when required basis throughout the post holder's period of employment. Mitie is an equal opportunity employer WHJS1_NI

Job type: Perm Rate of pay: £12.71 per hour + benefits Working days:4 days on 4 days off Working hours: Day shift & Night shift available (12 hour shifts) Location: Crumlin road, Belfast What you will do as a Cleaner: Ensure equipment is kept clean, well maintained and in safe working order and meeting all agreed SLAs Build your knowledge and understanding of the designated cleaning area, when the work needs to be carried out and all cleaning equipment and chemicals used on the premises while following Health and Safety requirements Undertake all training required to deliver the cleaning role Work within a team and can work under their own initiative Build positive and productive working relationships with all customers, delivery excellent customer service and seeking ways to continuously improve and exceed expectations. Benefits: Holiday entitlement(options to buy extra holiday) Pension contributions Discount through MiDeals to over 850 high street retailers Cycle to work Save as you earn scheme Virtual GP on hand for you and members of your household Life cover is the greater of your equivalent annual salary or a minimum of £10,000 - giving peace of mind for your dependants. We award our employees with Mitie Stars as recognition for their hard work. There are cash prizes up for grabs each month and at the end of the year there's a chance to scoop a top prize of £10,000! What you need: Ability to communicate and read basic English Previous cleaning experience is desirable but not essential and have a flexible approach to the role You will need to be open, honest, self-driven and determined You'll need to be reliable and hardworking with a professional attitude. Since 1987, Mitie's 68,000 employees have been maintaining companies globally. We are the UK's leading facilities management and professional services company, and our clients range from household names in banking, critical government sites as well as hospitals and schools Our market-leading flexible benefits scheme provides you with benefits that suit your lifestyle. We have a virtual GP on hand for you and members of your household. So you can get expert advice by video or phone without having to leave your home. We offer financial wellbeing assistance through our Salary Finance scheme. For example, you could access 50% of your earned pay before payday for a small fee. Salary Finance also offers competitive loans. When you join us, well give you a link to our flexible benefits platform, Choices. This gives you the chance to customise your benefits to best suit your lifestyle. You can choose from dental insurance, dining cards, coffee clubs, buying technology products at an affordable cost and much more! We give you access to high street discounts from thousands of well-known retailers, gyms and more through our MiDeals platform. And we have a cycle-to-work scheme. Life cover is the greater of your equivalent annual salary or a minimum of £10,000 - giving peace of mind for your dependants. We also offer a save-as-you-earn scheme, and a Mitie Matching Share Plan (you could even be awarded free shares in Mitie). We award our employees with Mitie Stars as recognition for their hard work. There are cash prizes up for grabs each month and at the end of the year theres a chance to scoop a top prize of £10,000! Our success is a direct result of the experience and quality of our people. Progressing your career is therefore a top priority for us. We offer a diverse variety of training and development avenues via a wide selection of learning resources to suit you. Since 1987, Mities 80,000 employees have been maintaining companies globally. We are the UKs leading facilities management and professional services company, and our clients range from household names in banking, critical government sites as well as hospitals and schools. WHJS1_NI

Honeycomb is pleased to be partnering with a prestigious international professional services organisation to recruit an experienced Executive Assistant for their Belfast office. This opportunity would suit a highly organised and proactive individual with experience supporting senior stakeholders within a corporate or professional environment. This position is initially offered on a 6-month contract basis, with strong potential for permanency. The Opportunity Joining a busy and collaborative team, you will provide dedicated support to senior leadership, ensuring the effective coordination of schedules, communications, travel, events, and wider operational activity. This is a varied role that requires excellent organisation, strong attention to detail, and the ability to manage multiple priorities in a fast-paced setting. The Company This global organisation has an excellent reputation for delivering high-quality professional services and is recognised for its supportive and forward-thinking culture. Employees are encouraged to develop professionally within a collaborative environment that values initiative, efficiency, and strong client service. Package & Benefits * Competitive salary dependent on experience * Generous annual leave and pension scheme * Hybrid working available * Monday to Friday working hours * 6-month contract with strong potential to become permanent * Ongoing training and career progression opportunities Key Responsibilities * Managing complex and constantly changing diaries for senior stakeholders, ensuring priorities and deadlines are effectively coordinated * Organising meetings, conferences, and appointments across various platforms including virtual and in-person settings * Coordinating domestic and international travel arrangements, including itineraries, accommodation, visas, and meeting logistics * Supporting the planning and coordination of internal and external events, hospitality, lunches, and business dinners * Acting as a central point of contact for clients, stakeholders, and internal teams, maintaining professional and timely communication * Monitoring and managing inboxes, correspondence, meeting requests, and incoming queries * Preparing reports, presentations, agendas, spreadsheets, and business documents to a high standard * Assisting with project coordination and tracking progress updates for senior leadership * Supporting business development activity through the preparation of pitches, client documentation, and maintaining CRM systems * Building and maintaining strong working relationships with clients and colleagues across the wider business * Ensuring records, databases, and documentation are maintained accurately and confidentially * Contributing to process improvements and supporting wider team initiatives and projects where required * Remaining up to date with company procedures, systems, and best working practices Candidate Profile * Minimum of 3 years' experience within an Executive Assistant, Senior Administrator, or Executive Support position * Previous experience within a legal, corporate, or professional services environment is advantageous * Exceptional organisational skills with the ability to manage competing priorities and tight deadlines * Strong communication and interpersonal skills with a professional and approachable manner * Ability to work independently while also collaborating effectively within a wider team * High level of accuracy and attention to detail * Strong knowledge of Microsoft Office including Outlook, Word, Excel, and PowerPoint * Confident preparing professional documentation and presentations * Strong problem-solving skills and the ability to use initiative * Professional, adaptable, and proactive approach to work * Interest in technology and improving processes is desirable To speak in absolute confidence about this opportunity, please send an up-to-date CV via the link provided or contact Caoimhe Fairfield at Honeycomb on . If you require any reasonable adjustments throughout the recruitment process, please contact us directly to discuss. Honeycomb is committed to equal opportunities for all applicants. Even if this role is not quite right for you, we may have others that are. Please visit Honeycomb to view our current opportunities. Skills: Executive Assistant EA PA Personal Assistant legal professional services Senior WHJS1_NI

Date: 5 May 2026 Location: Belfast, GB Job Function: Technical Business Unit: Andor Technology Senior Software QA Developer At Oxford Instruments Andor, we are devoted to accelerating the greatest scientific advancements of our age. It matters to us that the products we develop make a real difference to our customers and contribute significantly to their research. We want to deliver differentiated, accessible solutions to the widest possible scientific research and industrial communities. We are a market-leading organisation with a diverse and inclusive environment. We are hiring for a Senior Software QA / Developer who will work within the Software and Driver Development Team, extending and enhancing Andor's innovative scientific product portfolio. The role spans software and driver development, quality and test strategy, product requirements management, and support for customers and manufacturing. The Senior Software QA Developer will have: • BSc/BEng qualification in Electrical and Electronic/Software Engineering/Physics or equivalent relevant qualification OR equivalent relevant experience, • At least 5 years' experience in, • Software QA and/or Software developer role, • source control, • object orientated design using industry standard techniques and tools, • Proficient at developing test cases and test plans based on system requirements, • Proficient at scripting and programming, • Mental Health First Aiders, • Employee Assistance Programme (LifeWorks, Babylon, UnMind), • Private Medical Insurance with BUPA for you and your dependants, • Income Protection, Life Assurance and Personal Accident Insurance, • Company sick pay and medical leave, • Occupational Health Service, • Two days paid volunteering leave each year Money & Lifestyle, • Pension - employer contributory scheme (6%), • Share Incentive Plan, • Leave Purchase Scheme, • Cycle to Work Scheme, • Car Salary Exchange Scheme, • Tech Purchase Scheme, • Give As You Earn, • Employee discount scheme, • Free onsite parking Career, • Externally accredited training and development opportunities, • Support with professional qualifications, • LinkedIn Learning access, • Learning & Development programmes, • Service awards Work-Life Balance, • 187.5 holiday hours plus 9 customary holidays, • Flexible start and finish times, • Lunchtime finish on Fridays #LI-LD1 To be considered for this role you will be redirected to and must complete the application process on our careers page. To start the process click the Continue to Application below. WHJS1_NI

Learning and Development Consultant Artemis Human Capital is delighted to be partnering with an global, award-winning and exponentially growing professional services consultancy business based in Belfast in the recruitment of the newly created role of a Learning and Development Consultant. This is a fantastic opportunity for a Learning and Development specialist to have the opportunity to work a business that continually invests in each of their employee's personal development by providing you will tailored training, specialist support and ability to undertake professional qualifications to progress in your career. Within this role, you will deliver engaging L and D programmes to a range of esteem clients operating across various industries located across all of Northern Ireland. What will you receive as Learning and Development Consultant? • Up to £35,000 dependent upon experience, • Private Medical Insurance, • Enhanced Parental Leave, • Enhanced Annual Leave (32+days), • Opportunity to purchase additional annual leave, • Benefits Portal, • Hybrid working (1-2 days at home) dependent upon business projects What will you do as Learning and Development Consultant? • Deliver people development programmes (communication, presentation skills, readiness for leadership, managing up, difficult conversations, stakeholder engagement etc.), • Some first-line manager/supervisor level training, • Facilitate half-day, full-day, lunch & learn (virtual & in-person) sessions, • Deliver behavioural/experiential learning (facilitation style not slide-led training), • Manage own client portfolio autonomously, • Context switching between multiple client environments, • Design and prep work between delivery days What will you require as Learning and Development Consultant? • Proven experience in delivering L&D workshops (hands-on facilitation experience), • Skilled in delivering behavioural / soft skills / essential skills training, • Able to operate at pace in a consultancy-style environment, • Confident delivering both face-to-face and virtually (Teams/Zoom), • Comfortable with travel and changing environments, • Access to a car and have a full driving licence How to apply to this Learning and Development Consultant role? If you are an experienced Learning and Development professional seeking a role within a business that will invest in your development, skills and personal growth. Send an updated CV to , contact Caitlin Scollan on or message Caitlin Scollan directly on Linkedin to discuss the position in confidence. Skills: Training Learning and Development Client Management WHJS1_NI

Learning and Development Consultant Artemis Human Capital is delighted to be partnering with an global, award-winning and exponentially growing professional services consultancy business based in Belfast in the recruitment of the newly created role of a Learning and Development Consultant. This is a fantastic opportunity for a Learning and Development specialist to deliver engaging L and D programmes to a range of esteem clients operating across various industries located across all of Northern Ireland. In addition, you will work within a business that continually invests in each of their employee's personal development by providing you will tailored training, specialist support and ability to undertake professional qualifications What will you receive as Learning and Development Consultant? Up to £35,000 dependent upon experience Private Medical Insurance Enhanced Parental Leave Enhanced Annual Leave (32+days) Opportunity to purchase additional annual leave Benefits Portal Hybrid working (1-2 days at home) dependent upon business projects What will you do as Learning and Development Consultant? Deliver people development programmes (communication, presentation skills, readiness for leadership, managing up, difficult conversations, stakeholder engagement etc.) Some first-line manager/supervisor level training Facilitate half-day, full-day, lunch & learn (virtual & in-person) sessions Deliver behavioural/experiential learning (facilitation style not slide-led training) Manage own client portfolio autonomously Context switching between multiple client environments Design and prep work between delivery days What will you require as Learning and Development Consultant? Proven experience in delivering L&D workshops (hands-on facilitation experience) Skilled in delivering behavioural / soft skills / essential skills training Able to operate at pace in a consultancy-style environment Confident delivering both face-to-face and virtually (Teams/Zoom) Comfortable with travel and changing environments Access to a car and have a full driving licence How to apply to this Learning and Development Consultant role? Send an updated CV to , contact Caitlin Scollan on or message Caitlin Scollan directly on Linkedin to discuss the position in confidence. Skills: Training Learning and Development Client Management

Why Apply for this Role? Excellent opportunity within a well-established and recognised organisation in Belfast Supportive finance team with strong internal collaboration Free on-site parking 31 days annual leave rising to 34 days (pro rata for part-time staff) Attractive benefits package including pension, life assurance and health cash plan A fantastic opportunity has arisen for an Accounts & Administrative Officer to join the finance team within an established non profit organisation, supporting accurate financial administration across a diverse and fast-paced organisation. About the Company A leading leisure, entertainment and events organisation based in Belfast, operating high-profile venues. The Group employs a collaborative team-based approach and offers a supportive working environment with excellent staff benefits and long-term stability. About the Job Reporting to the Finance Manager and working as part of a team, the successful candidate will assist with the maintenance of financial records, production of financial information and a range of administrative duties. This role supports multiple business units and requires a high level of accuracy, organisation and flexibility. Key Responsibilities Assisting with the maintenance of accurate financial records Supporting the production of financial information and reports Undertaking general finance and administrative duties Working across multiple business units Using accounting software and Excel spreadsheets to support finance processes Liaising with internal teams and external bodies as required Supporting the finance team with ad-hoc administrative tasks as required Your Skills & Experience Minimum of 1 years experience within the last three years in an administrative role within a financial environment Experience using an accounting software package Strong IT skills, particularly Excel Excellent organisational and communication skills Strong interpersonal skills with the ability to build effective working relationships Ability to work accurately under pressure and meet deadlines Ability to work effectively as part of a team Desirable Experience using Office 365, PowerPoint and Word Experience using an automated purchase-to-pay system For further information on this opportunity or if you are considering the next step in your finance career, get in touch withOllie Mairs at HireIQ in complete confidence. Skills: Invoicing Admin Duties

Expert Construction is currently seeking an experienced intermediate Health & Safety Advisor to support the health and safety function. for our established Client for their significant Residential project in Belfast. . As the Health & Safety Advisor you will play a supporting role in establishing and managing the Safety, Health, Environment, and Quality function for our sites. You will ensure all company health and safety procedures are maintained to a high standard, working closely with the construction team including Site Managers and the SHEQ Manager. You will be supported by a Senior Health & Safety Manager. Main duties / key responsibilities ? Assist with the compilation and implementation of H&S procedures, policies and other documentation ? To ensure the effective maintenance and improvement of the Integrated Management system in relation to the ISO 45001 & ISO ) standards and Safe T Certification ? Conduct general Risk Assessments and Method Statements throughout all projects ? Review and approve all Subcontractors Risk Assessments and Method Statements ? Ability to negotiate with statutory authorities if required ? Ability to negotiate with Subcontractors if required ? Conduct workplace audits and report findings of non-compliance to Senior SHEQ Manager, Contracts Manager and Site Managers ? Coordinate and accompany contractors on site visits ? To visit sites to ensure that subcontractors are adhering to all H&S requirements ? Promote a positive H&S culture within the Company and site portfolio whilst recommending new initiatives for continuous improvement ? Undertake Visible Felt Leadership visits with Site Management team and Senior SHEQ Manager ? Co-ordinate the availability of persons and facilities to ensure managers, supervisors and employees attend and complete identified H&S training in order to improve company performance as necessary ? To identify improvement activities and training needs and give feedback of findings to Senior SHEQ Manager ? To advise Site Supervisors on compliance and Monitoring all subcontractors and companies plant and to ensure compliance ? Assist the company in reviewing and implementing all the necessary RAMS documentation in line with their third party contract requirements ? Carry out any other reasonable request made by your line manager to support site, departmental or company objectives As the Health & Safety Advisor , you will assist various departmental managers with HSE tasks to ensure company compliance for the site, ensuring managers are proactive and create a positive culture in accordance with the business aims. You will work with various teams to help develop line management capability and the implementation of good people management practices, providing advice and support on complex matters. Essential Criteria: ? A NEBOSH General Certificate or NEBOSH Construction Certificate in Health & Safety ? Experience gained in a similar role. (minimum of 2 years ) ? Knowledge of current Health, Safety and Environmental Legislation ? A good working knowledge of Risk assessments, COSHH, RIDDOR and Display Screen Equipment ? Ability to demonstrate significant experience of working within a construction environment. (preferably Housebuilding) ? Capable of working with processes & procedures. ? Clear & concise communicator Desirable but not essential: ? NEBOSH Fire Safety and Risk Management Certificate ? NEBOSH Environmental Certificate or similar ? NEBOSH Certificate in Health and Well-being at work ? Experience with management systems; ISO14001 & ISO ) Knowledge, Skills, and Abilities: ? Self-motivated with high energy ? Team player with adaptability ? Negotiation skills Customer-focused ? Action-oriented ? Excellent communication skills ? Ability to influence at all levels ? Integrity, honesty, and trust ? Drive for results ? Excellent listening skills ? Business acumen ? Perseverance Hours 42.5 In return for your skills and experience, you will receive: ? Competitive salary ? 20 days Annual Leave ? An excellent team to work with ? Permanent role This is an outstanding role, where the Senior Health & Safety Manager and the management team play a key role in your development within the organisation. Please contact Kevin on for further information or forward your CV using the link below. Skills: Health & Safety Advisor Health & Safety Officer SHEQ Officer

Job Purpose/Summary: The Property Director will be responsible for leading and transforming the entirety of the Praxis property function, shifting the department from a reactive service to a strategic, proactive asset management engine. This is a pivotal transformational role, responsible for leading the function through a major change management period to support the organisations mission, vision and goals. With the objective of creating standardised processes which will enable the organisation to scale its property portfolio, the role holder will be responsible for championing and embedding a culture of excellence. The Property Director will work in partnership with the Senior Leadership Team to implement the systems, policies, and structures aligned to the organisations long-term strategy. The successful candidate will oversee the full-portfolio maintenance and capital investment, ensuring that all properties are managed in a safe, compliant, and efficient manner always putting the people Praxis Care supports at the heart of every decision. All applicants for positions at the level of Manager or above within Praxis Care are required to disclose any actual, potential, or perceived conflicts of interest. This includes any direct or indirect involvement with individuals, firms, companies, or organisations that have, or are seeking to establish, a contractual relationship with Praxis Care. Failure to declare such interests may result in disqualification from the recruitment process. If a conflict of interest is identified after an appointment has been made, it may constitute grounds for disciplinary action, up to and including dismissal. Key Accountabilities Strategy Lead the strategic direction of the property function in line with organisational goals, creating and rolling out standardised policies, processes, controls, and documentation across all four jurisdictions ensuring that property strategy and delivery supports high-quality, safe, and person-centred care environments Define and deliver the full-portfolio planning strategy, leading the transition from a reactive maintenance model to a planned programme with a portfolio-wide schedule. Oversee the strategic management of housing partners, maintaining Service Level Agreements and Joint Management Agreements to ensure all roles, responsibilities, and documentation are current and enforced. Develop the property pipeline to support organisational growth plans. Provide strategic oversight for all legal and commercial matters, including lease management, conveyancing, acquisitions, disposal and liaison with solicitors. Advise senior leadership in significant property investments and risks. Leadership . Lead change management across the property function, ensuring successful adoption of new systems, processes, and ways of working Manage and mentor the Assistant Director and wider team, ensuring staff are working effectively and executing the strategic vision defined by the Property Director. Champion and embed a culture of high performance and ownership, ensuring the property team is proactive and provides reliable support to operational colleagues. Establish formal contracts for surveyors, architects, builders and other contractors, managing these high-level relationships to ensure high-quality service delivery. Develop and implement a performance framework for the property function, including KPIs relating to compliance, maintenance, cost control, and asset performance Ensure the property function interface with across the organisation in particular with Finance, Operations and Governance is robust, particularly regarding legal, regulatory, Health & Safety and Fire Safety requirements. Finance & Procurement Accountable for planning and delivery of capital upgrades and major project management, ensuring strict time and budget assurance. Oversee all financial aspects of the property portfolio, including the management of funds and the alignment of property spend with the organisations long-term strategic plan. Implement a formal procurement strategy to onboard maintenance contractors across all localities on reactive frameworks, ensuring value for money and consistent service quality and robust project and contract management. Collaborate with the Finance function to ensure rigorous adherence to procurement policies, including quotes, tenders, authorisation, and value for money Digital Lead the selection and implementation of a property management system which will fit for purpose for now and for the future and will support the organisation on achieving its overall corporate objectives. Drive the modernisation and digitalisation of the property function, ensuring the system enables robust data capture, accurate risk identification, and proactive maintenance response capabilities. Leverage the new system to enable portfolio-wide visibility and reporting, providing assurance to the Executive Team and Board that all properties are compliant with statutory and regulatory requirements, with clear visibility of risk and mitigation PRAXIS CARE IS AN EQUAL OPPORTUNITIES EMPLOYER. About The Role Requirements of the role: You will be required to be involved in the company performance management process. To adhere to, and model the company values, behaviours and competencies at all times. To carry out all duties of the post in accordance with Praxis rules, regulations and policies. To carry out additional duties of the role and all other required duties as and when necessary. The above mentioned duties are not exhaustive and the post holder will be required to carry out other duties as and when necessary. It should be noted that stated duties or location associated with the post may change to meet the future needs of the organisation. Experience & Qualifications: • Essential: 5 years experience in a senior property management and leadership role with responsibility for leading large-scale, multi-jurisdictional portfolios and managing change management programmes. • Successful track record in planning, executing, and improving work processes, shifting maintenance models from reactive to planned/proactive methodologies., • Proven track record of creating and embedding team KPIs, clearly communicating expectations, and tracking performance against agreed metrics., • Strong project management experience with a proven track record of successfully planning and monitoring capital development schemes, gaining buy-in from multiple stakeholders., • Significant experience in procurement and contractor management, including establishing frameworks and managing external service partners., • Educated to a degree level (holds a qualification classified atLevel 6or higher)., • Background within the charity, housing, or social care sectors., • Engineering or RICS-accredited professional membership/qualification., • Experience of managing property functions across multiple jurisdictions., • Technical/Functional Excellence Excellent planning and organisational skills, using all tools necessary to ensure the smooth running of a large, complex property portfolio. • Capability to accurately assess complex and strategic situations, whilst promoting cooperation and collaboration with internal operational stakeholders and external housing partners., • Exemplary leadership, negotiation and influencing skills, demonstrated by sustained impacts within an organisation and the ability to inspire enthusiasm at all levels., • Demonstrates strong knowledge of project management processes, tools, and techniques, coupled with the ability to adapt these to the organisations growth targets. Required Criteria • Educated to a degree level (holds a qualification classified at Level 6 or higher)., • Full Driving License, • 5 years experience in a senior property management and leadership role with responsibility for leading large-scale, multi-jurisdictional portfolios and managing change management programmes. Desired Criteria • Professional qualification in any of the following professions: Chartered Surveyor, Quantity Surveyor, Building Surveyor, Architect, Civil Engineer, Facilities management, • Recognised Project Management accreditation, • Recognised Property/ Estates Management accreditation Skills Needed Contract Negotiation, Project Management, Communication, Teamwork About The Company Praxis Care provides a wide variety of services to vulnerable adults and children, supporting individuals with mental ill health, learning disabilities, autism and dementia. Our staff teams are essential to ensuring the provision of these services. As a new member to the team, you can expect to be trained and supported in a structured fashion to achieve the high standards expected by the people we support and mandated by our regulators. Company Culture Our core values include compassion, integrity, teamwork, innovation and resilience. We also ensure that kindness and respect is integral to every role within Praxis Care and these values are fundamental to the provision of care we deliver to the people we support. If you are interested in a role that is rewarding, varied and positively impacts the lives of those we support, then we want to hear from you. Company Limited By Guarantee | Registered Office 25-31 Lisburn Road, Belfast, BT9 7AA| Registered in Northern Ireland (NI ) | Registered with the Charity Commission Northern Ireland (NIC ) | Registered in Ireland ) | Registered Office: Unit 18, Ardee Business Park, Hale Street, Ardee, Co Louth, A92 XH76 | Registered with Charities Regulatory Authority ) | ?Registered as a Charity in the Isle of Man (0826) Company Benefits Why Join Praxis Care? * Great Work Environment : Compassionate, supportive, and inclusive team culture. * CARE for Your Physical & Mental Health : Access to occupational sick pay, a confidential counselling service, and employer-funded healthcare schemes. * Financial Benefits : Competitive salary, pension plan, and refer-a-friend bonuses. * Career Development : Continuous professional development with opportunities to gain recognized qualifications, such as QCF3/5, and clear career progression pathways. * Work-Life Balance : Paid annual leave which increases with length of service, and flexibility in working hours. * Other Perks : PPE provided, long service awards, savings via the Cycle to Work scheme, and coming soon, early access to earned wages through salary advance software. Vacation, Paid time off, Paid sick days, Flexible schedule, Employee discounts, Sabbatical leave, Cycle to work, Referral bonus, Competitive salary, Long service recognition, Employee Assistance Scheme, Wellbeing Scheme, Social Opportunities, Employee Recognition Scheme, Culture of recognition, On the job learning, Progression opportunities, Long service awards, Service recognition increases to annual leave Salary Not disclosed Skills: Contract Negotiation Project Management Communication Teamwork Benefits: Vacation, Paid time off Paid sick days Flexible schedule Employee discounts Sabbatical leave Cycle to work WHJS1_NI

Discover an exciting opportunity to join an established, high street insurance broker committed to delivering exceptional service and solutions. As a Claims Handler, you'll play a vital role in managing client claims with professionalism and care, ensuring every customer experience is positive and compliant with industry standards. Salary & Benefits: • Competitive salary package, • Generous annual leave entitlement, • Pension scheme contributions, • Private medical cover, • Life assurance, • Free annual eye tests About you: • Previous experience in a Claims Handler role, ideally with broker or insurer backgrounds, • Knowledge of the end-to-end claims process and insurance cover basics, • Strong organisational skills with high accuracy and attention to detail, • Excellent communication and interpersonal skills to build effective relationships, • Proficient in Microsoft Office, with experience in systems like Acturis or Open GI being advantageous, • Motivated to deliver outstanding customer service and professional to handle queries confidently, • Manage a variety of claims including motor, household, commercial, liability, and personal injury, • Accurately process claims from notification to settlement, liaising with insurers, loss adjusters, and clients, • Provide expert advice on policy coverage and loss mitigation, • Liaise with internal teams and external stakeholders to ensure claims are handled efficiently, • Identify complex or high-value claims and escalate appropriately, • Ensure compliance with FCA regulations, company policies, and best practices Follow VANRATH on LinkedIn for expert career advice, the latest jobs, industry news and much more Skills: Claims Insurance Broking Commercial Investigation Benefits: Healthcare Life Insurance. WHJS1_NI

Your new company The services of Hays have been retained by our client, Alpha Housing, to recruit a Housing Officer for a minimum of 12 months to cover a period of maternity leave. Alpha currently manages a stock of c. 1,000 homes in 40 locations across Northern Ireland. Homes are mainly sheltered housing for older people living independently. The stock also consists of an increasing number of family homes through the growing newbuild programme. Your new role Reporting to the Head of Homes and Communities, you will be responsible for providing an effective and comprehensive range of Housing Management services, including: • Allocating properties in accordance with the rules of the NI Housing Selection Scheme and the Association's policies., • Signing up new tenants, providing advice on all tenancy matters, services of the Association, welfare and benefit entitlement., • Managing the effective and efficient turnaround of all void properties in conjunction with maintenance colleagues and in line with the Association's policies and procedures., • Liaising with Development colleagues, attending site meetings as required to prepare for handover and commencement of new tenancies., • Managing anti-social behaviour cases, liaising with relevant bodies and adhering to policies and procedures., • Ensuring delivery of housing and support services at schemes by the scheme staff, including completion and review of individual needs and risk assessments of tenants., • Working with Finance colleagues to ensure the payment of weekly charges by all tenants and take appropriate action in relation to arrears recovery in line with policies and procedures., • Supervising the Scheme Co-ordinator in each of the schemes within the designated housing patch., • Carrying out site visits to schemes at agreed intervals to provide support to scheme staff. What you'll need to succeed To be considered for this position, you must possess: A relevant 3rd level housing qualification and a minimum of 1 years' experience within a housing environment, or; A degree in any discipline and 2 years' relevant housing management experience, or; 3 years' experience as a Housing Officer within the last 5 years. You will also possess: I. Working knowledge of the rules of the Housing Selection Scheme, including running waiting lists, allocating properties and managing transfers. II. Excellent communication skills both written and oral. III. A high level of organisational skills and the ability to work to deadlines. IV. Interpersonal skills and the ability to liaise with a range of people. V. Supervisory skills. VI. Ability to work within a team but willing to use your own initiative to take the lead when necessary. VII. Working knowledge of MS Office packages. What you'll get in return Alongside a competitive basic salary, this role comes with: • Essential car users allowance of £1,239 per annum., • Annual incremental progression through the salary scale is dependent on satisfactory performance. There is also an annual cost of living increase., • A defined contributory pension scheme with the employers' contribution set at 10% of annual salary., • Hybrid working, with two fixed days per week in the office, currently Tuesdays and Thursdays., • Flexible start and finish times., • Car parking on-site., • The organisation encourages and supports personal and career development, such as funding colleagues to obtain professional qualifications or providing time to participate in sector initiatives and working groups. What you need to do now Please contact Andrew McLarnon to discuss this position in confidence. Alternatively, please apply using the link attached to register your interest. Hays Specialist Recruitment Limited acts as an employment agency for permanent recruitment and employment business for the supply of temporary workers. By applying for this job you accept the T&C's, Privacy Policy and Disclaimers which can be Skills: Housing Officer Housing Management Patch Manager Benefits: £33 366 - £38 626 per annum WHJS1_NI

PRODUCTION OPERATIVE (BUFFING/ HAND FINISHING) AProductionOperative(Buffing)intheMachineShopisresponsibleforBuffingandhandfinishingmachinedpartstoahighcosmeticstandardusinghandheld powertools and manualequipment. Duties and Responsibilities • Responsibleforbuffingandhandfinishingmachinedpartstoahighcosmeticstandardusinghandheldpowertools., • Responsibleforcleaningandmaintenanceofallpowertoolsusedinthebufferingprocess., • Managestocklevelsofallconsumablesusingthebuffering processandliaisewithmanagementtoreorderifnecessary., • Responsibleforvisualqualitycontrolonalloutgoingpartsthathavebeenbuffed.ThiswillagainbecheckedbyQCafterwards., • Communicatewellbetweenmachineoperators,qualitycontroland management., • Haveakeeneyefordetail., • Abletoworkindependentlyinafast-pacedmachineshop., • Knowledgeoforexperienceusingorbitalsandersandorhand files., • 39HoursPerweek, • Freecarparkingonsite, • Well-beingHealthPlan, • 28 Days annual leave (Increase after 5 years) Skills: Production Operative Engineering Production Operator Machine Operator WHJS1_NI

Honeycomb is delighted to be partnering with a highly regarded Belfast law firm in the search for a Legal Secretary to join their expanding team. The Opportunity This is a fantastic chance to provide comprehensive secretarial and administrative support to solicitors within a busy Healthcare team. The role would suit someone who thrives in a fast-paced legal environment, particularly with experience in regulatory work, professional defence, or client-focused legal services. You will be supporting a team that advises a broad client base, including professionals, private practices, and care providers. About the Firm This organisation has built a strong reputation across Northern Ireland for delivering exceptional legal services. Known for its collaborative and supportive culture, the firm is committed to staff development and progression. High standards, attention to detail, and professionalism are at the core of how the team operates. Salary & Benefits • Competitive Market leading salary, • Generous annual leave entitlement, • Additional day off for your birthday, • Private healthcare cover, • Cycle to Work scheme, • Pension contribution, • Ongoing career development and progression opportunities, • Volunteering initiatives with the firm's chosen charity, • Employee wellbeing programmes Key Responsibilities • Preparing, formatting, and reviewing legal documents, contracts, and correspondence using the firm's case management system, • Organising and maintaining files, ensuring all records are accurate and up to date, • Producing reports, minutes, and other supporting documentation, • Audio typing and transcription as required, • Providing day-to-day administrative support to the wider team, • Assisting with case preparation and file management, • Communicating professionally with clients, colleagues, and stakeholders, • Managing workloads effectively to meet deadlines in a busy setting, • Maintaining a consistently high standard of work and client service About You • At least 1 year's experience in a Legal Secretary or Legal Support position covering any area of law, • Experience within regulatory, professional services, or client-facing legal environments is desirable, • Strong organisational skills with excellent attention to detail, • Clear and confident communication skills, both written and verbal, • Ability to prioritise and manage a varied workload, • Comfortable working independently as well as part of a team, • A proactive, reliable, and professional approach For a confidential discussion about this opportunity, please submit your CV via the link or contact Caoimhe Fairfield at Honeycomb on . If you require any adjustments during the recruitment process, please let us know and we will be happy to assist. Honeycomb is an equal opportunities employer. If this role isn't quite right for you, feel free to get in touch or visit our website to explore other current opportunities. Skills: legal secretary legal adminsitrator law legal assistant litigation healthcare WHJS1_NI